DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta3GalTII and CG8668

DIOPT Version :9

Sequence 1:NP_610399.1 Gene:beta3GalTII / 35848 FlyBaseID:FBgn0033315 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001285740.1 Gene:CG8668 / 34107 FlyBaseID:FBgn0031988 Length:585 Species:Drosophila melanogaster


Alignment Length:300 Identity:71/300 - (23%)
Similarity:109/300 - (36%) Gaps:73/300 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PYLPEELIYLPTFNAQGHLQVELVAEQ----------------------ASRLRQYTNWQQSLLT 125
            |..|.:.:...|....||:..|:.||:                      |:|:.....|...   
  Fly   305 PVDPSKGVATETLYEPGHVDEEIDAERICPKGGEFIKLLVLISSAMSHDAARMSIRQTWMHY--- 366

  Fly   126 EGPPRTKRLITVKHVFSIGTLDLSSSALAELEKEQNQNNDL---LLLNRHHDTYKNLTAKLMQSL 187
                .|:|.:.:..|...||.:..:.||       .|.|.:   |:.....|:|.|||.|.:.:|
  Fly   367 ----GTRRDVGMAFVLGRGTNETINKAL-------TQENFIYGDLIRGNFIDSYNNLTLKTISTL 420

  Fly   188 YILRRHY-EFSYMLKVDDDTYVKLDSLVNTLVSYDRKLLRKRSEYRDHVLPQLYWGYFNGRSTIK 251
            .....|. :..|:||.|||.::.:..|:..|    .|...||:.|              ||...|
  Fly   421 EWADVHCPKAKYILKTDDDMFINVPKLLTFL----DKHKDKRTIY--------------GRLAKK 467

  Fly   252 TKG-QWKESSYYLSKN------YLPYALGGGYVLSRSLCDYIVNNSQLLSHYGSEDVSVGTWLAP 309
            .|. :.|:|.||:|.:      :..:..|..|||:..:...:...|....:...|||.....:|.
  Fly   468 WKPIRNKKSKYYVSVDQFAAGVFPSFTTGPAYVLTGDIVHELYVRSLKTVYLKLEDVFTTGIVAK 532

  Fly   310 LRHVYRWHDPRF---DTSYAP---RKCRSYHMVLHKRNGQ 343
            ..:|.|.....|   ..|:.|   |...|.||:  |.|.|
  Fly   533 SLNVKRVQANEFVNRRISFNPCNIRNAISVHMI--KSNEQ 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta3GalTIINP_610399.1 Galactosyl_T 125..319 CDD:304462 50/204 (25%)
CG8668NP_001285740.1 Galactosyl_T 354..540 CDD:304462 53/217 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465001
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.