DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta3GalTII and CG8673

DIOPT Version :9

Sequence 1:NP_610399.1 Gene:beta3GalTII / 35848 FlyBaseID:FBgn0033315 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster


Alignment Length:291 Identity:65/291 - (22%)
Similarity:114/291 - (39%) Gaps:60/291 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LPEELIYLPTFNAQGHLQVELVAEQASRLRQYTNWQQSLLTEGPPRTKRLITVKH---------- 139
            :|..:..:.|....|||..|:..|:....:..:.....|:|.....:...::::.          
  Fly   139 VPVRMPLVKTIYKPGHLDSEIDMERICPQKGLSTQLLVLITSSLRHSAARMSIRQTWMHYGSRRD 203

  Fly   140 ---VFSIGTLDLSSSALAELEKEQNQNNDLLLLNRHH--DTYKNLTAKLMQSLYILRRHY-EFSY 198
               .|.:|. ..:.|....:::|.....||:   |.|  |:|.|||.|.:..|.....|. :..|
  Fly   204 VGMAFVLGK-GKNKSVKKAIDQEDFMYQDLI---RGHFIDSYNNLTLKTISLLEWADLHCPKAKY 264

  Fly   199 MLKVDDDTYV---KLDSLVNTLVSYDRKLLRKRSEYRDHVLPQLYWGYFNGRSTIKTKGQWKESS 260
            :||.|||.::   ||.:|::||.: :|.:..:|:|         .|.....|        |  |.
  Fly   265 VLKTDDDMFINVPKLLTLISTLKA-NRTIYGRRAE---------NWKPIRNR--------W--SK 309

  Fly   261 YYLS-----KNYLPY-ALGGGYVLSRSLCDYIVNNSQLLSHYGSEDVSVGTWLAPLRHVYRWH-- 317
            |::|     |...|| ..|..|:|:..:...:...|...:....|||.....:|...::.|.:  
  Fly   310 YHISNAQYGKPTFPYFTTGPAYLLTGDIVHALYVQSLNTAFLKLEDVFTTGIVAESLNIRRVNVR 374

  Fly   318 -----DPRFDTSYAPRKCRSYHMVLHKRNGQ 343
                 ..:|:|.:...|. :.|||   ||.:
  Fly   375 EMANTRTKFETCHIRDKI-TIHMV---RNNE 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta3GalTIINP_610399.1 Galactosyl_T 125..319 CDD:304462 49/225 (22%)
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 48/211 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465002
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.