DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta3GalTII and CG30037

DIOPT Version :9

Sequence 1:NP_610399.1 Gene:beta3GalTII / 35848 FlyBaseID:FBgn0033315 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster


Alignment Length:398 Identity:93/398 - (23%)
Similarity:142/398 - (35%) Gaps:111/398 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 AHRSRIPHLEPH-------PNLF------LMVLVLSAPHNADERNAMRRTWLANAGQSIAQPYLP 86
            |.||...:|:|.       |..|      |.:.|.|..|:.:.|.|:|:.|    |..       
  Fly    61 APRSVADYLDPTKDTALIVPRHFCRSKALLTIAVCSYVHHFERRRAIRKLW----GNF------- 114

  Fly    87 EELIYLPTFNAQGHLQVELVAEQASRLRQYTNWQQSLLTEGPPRTKRLITVKHVFSIGTLDLSSS 151
            .:..|.......|||:.........||:.|:.:   |..||   .....:::.||.:|..:|:| 
  Fly   115 TDFNYSVFVKLHGHLKGRYQDVLPERLKLYSEY---LSGEG---DSLRASIRLVFIVGRRNLAS- 172

  Fly   152 ALAELEK---EQNQNNDLLLLNRHHDTYKNLTAKLMQSLYILRRHYEFS------YMLKVDDDTY 207
             |.|.|.   |..:.||::..| ..|||.|||.|.:.:|    :|...|      :..|.||||:
  Fly   173 -LLENEAVAIEAQKYNDVIQEN-FIDTYNNLTIKAVMAL----KHITQSCLNTTAFYFKCDDDTF 231

  Fly   208 VKLDSLVNTL---------------------VSYDRKLLRKRSEY---RDHVLPQLYWGYFNGRS 248
            |.:.::::.|                     |:..||.|..|.|.   |.|.         |...
  Fly   232 VNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTARREMMYGRQHC---------NVPP 287

  Fly   249 TIKTKGQWKESSYYLSKNYLP-YALGGGYVLSRSLCDYIVNNSQLLSHYGSEDVSVGTWLAPLRH 312
            ......:|...||.......| |..|.||:||..:...:...|........||:.|....|....
  Fly   288 ATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKASLGTRIVHLEDMFVTGLCAEKAG 352

  Fly   313 VYRWHDPRFDTSYAPRKCRSYHMVLHKRNGQMMRDIHDG-ELCSGIGS--------SILSDYYYD 368
            :.|.:.|.|.:||.                      ::| |.|:..||        :::.:.:|.
  Fly   353 IKRTNHPLFRSSYP----------------------YEGDEQCALKGSFTVHRAKDNVMWEAWYR 395

  Fly   369 WTRTADKC 376
            .|..:.||
  Fly   396 VTNFSSKC 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta3GalTIINP_610399.1 Galactosyl_T 125..319 CDD:304462 56/227 (25%)
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 69/289 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465007
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.