DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta3GalTII and B3gnt8

DIOPT Version :9

Sequence 1:NP_610399.1 Gene:beta3GalTII / 35848 FlyBaseID:FBgn0033315 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001031817.1 Gene:B3gnt8 / 232984 MGIID:2385269 Length:389 Species:Mus musculus


Alignment Length:295 Identity:65/295 - (22%)
Similarity:103/295 - (34%) Gaps:92/295 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 FLMVLVLSAPHNADERNAMRRTWLANAGQSIAQPYLPEELIYLPTFNAQGHLQVELVAEQASRLR 114
            :|::.|.|.|.:...|.|:|.||        ..|.....|::|                      
Mouse   141 YLLLAVKSEPGHFAARQAVRETW--------GSPVAGTRLLFL---------------------- 175

  Fly   115 QYTNWQQSLLTEGPPRTKRLITVKHVFSIGTLDLSSSALAELEKEQNQNNDLLLLNRHHDTYKNL 179
                 ..|.|..|.|..:.|:|                     .|..:..||||.: ..|...|.
Mouse   176 -----LGSPLGMGGPDLRSLVT---------------------WESRRYGDLLLWD-FLDVPYNR 213

  Fly   180 TAKLMQSLYILRRHY-EFSYMLKVDDDTYVKLDSLVNTLVSYDRKLLRKRSEYRDHVLP-----Q 238
            |.|.:..|..|..|. :.:::|:|.||.:|.:.:|:..|                ..||     .
Mouse   214 TLKDLLLLTWLSHHCPDVNFVLQVQDDAFVHIPALLEHL----------------QTLPPTWARS 262

  Fly   239 LYWG--YFNGRSTIKTKGQWKESSYYLSKNYLPYALGGGYVLSRSLCDYIVNNSQLLSHYGSEDV 301
            ||.|  :...:...|..|.:.....:...:|..||.|||||:|..|..:::..:..::.:..:||
Mouse   263 LYLGEIFTQAKPLRKPGGPFYVPKTFFEGDYPAYASGGGYVISGRLAPWLLQAAARVAPFPFDDV 327

  Fly   302 SVG-----TWLAPLRHVYRWHDPRFDTSYAPRKCR 331
            ..|     ..|||..|      |.|.|::...:.|
Mouse   328 YTGFCFRALGLAPRAH------PGFLTAWPAERTR 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta3GalTIINP_610399.1 Galactosyl_T 125..319 CDD:304462 47/206 (23%)
B3gnt8NP_001031817.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..57
Galactosyl_T 154..341 CDD:389837 55/259 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D640360at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.