DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta3GalTII and B3GALNT2

DIOPT Version :9

Sequence 1:NP_610399.1 Gene:beta3GalTII / 35848 FlyBaseID:FBgn0033315 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_006711812.1 Gene:B3GALNT2 / 148789 HGNCID:28596 Length:586 Species:Homo sapiens


Alignment Length:416 Identity:87/416 - (20%)
Similarity:139/416 - (33%) Gaps:174/416 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LMVLVLSAPHNADERNAMRRTWLANAGQ--SIAQ----------------------PY------- 84
            ::|.||||.:|.:.||.:|.||:.:..|  :::|                      ||       
Human    53 VVVGVLSARNNHELRNVIRSTWMRHLLQHPTLSQRVLVKFIIGAHGCEVPVEDREDPYSCKLLNI 117

  Fly    85 ---------------------LPEELIYLPTFNA--------------------QGHLQVELV-A 107
                                 |||:.:...:|..                    |.::.|:|. |
Human   118 TNPVLNQEIEAFSLSEDTSSGLPEDRVVSVSFRVLYPIVITSLGVFYDANDVGFQRNITVKLYQA 182

  Fly   108 EQASRL----------------RQYTNWQQSLLTEGPPRT------------------------- 131
            ||...|                ..|...:|.:|.|....|                         
Human   183 EQEEALFIARFSPPSCGVQVNKLWYKPVEQFILPESFEGTIVWESQDLHGLVSRNLHKVTVNDGG 247

  Fly   132 --KRLIT-----VKHVFSIGTLDLSSSALAELEKEQNQNNDLLLLNRHH---------------- 173
              .|:||     :.|.|..|...::...:..:     |..|.||.|.|.                
Human   248 GVLRVITAGEGALPHEFLEGVEGVAGGFIYTI-----QEGDALLHNLHSRPQRLIDHIRNLHEED 307

  Fly   174 -------------------DTYKNLTAKLMQSLYILRRHYEFSYMLKVDDDTYVKLDSLVNTLVS 219
                               |||:|:.|||:...........|:.:||.|||.|:.|:::.|    
Human   308 ALLKEESSIYDDIVFVDVVDTYRNVPAKLLNFYRWTVETTSFNLLLKTDDDCYIDLEAVFN---- 368

  Fly   220 YDRKLLRKRSEYRDHVLPQLYWGYFNGRSTIKTKGQWKESSYYLSKNYLPYALGGGYVLSRSLCD 284
               ::::|..:.     |..:||.|.....:...|:|:|.. |.|..|..:|.|.|||:|:.:..
Human   369 ---RIVQKNLDG-----PNFWWGNFRLNWAVDRTGKWQELE-YPSPAYPAFACGSGYVISKDIVK 424

  Fly   285 YIVNNSQLLSHYGSEDVSVGTWLAPL 310
            ::.:||..|..|..||||:|.|:|.:
Human   425 WLASNSGRLKTYQGEDVSMGIWMAAI 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta3GalTIINP_610399.1 Galactosyl_T 125..319 CDD:304462 58/253 (23%)
B3GALNT2XP_006711812.1 Galactosyl_T 307..457 CDD:304462 44/157 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D640360at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.