DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps25 and VPS25

DIOPT Version :9

Sequence 1:NP_610398.1 Gene:Vps25 / 35847 FlyBaseID:FBgn0022027 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001319990.1 Gene:VPS25 / 827637 AraportID:AT4G19003 Length:179 Species:Arabidopsis thaliana


Alignment Length:179 Identity:60/179 - (33%)
Similarity:107/179 - (59%) Gaps:11/179 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEFQWPWEYTFPPFFTLQPHEETRQQQLKVWTDLFLKYLRHTNRFTLSIGDQNSPLFHNEALKR 65
            :|:|:.|..:.:||:|||||..:||::|:::|.:|.|.|.:....|.:.: :::.|||.|.|:.|
plant     4 LADFKLPQFFNYPPYFTLQPVRDTREKQIQLWKELILDYCKSQKIFLIGV-EEDFPLFSNSAIDR 67

  Fly    66 RLSPE----LVLAILGELERSGHANPLDKRRQEWQVYWFTLEEYGNMVYDWVQETGQTNTICTLY 126
            .||.|    .:.||:||    |.|..|||..::..:.|..::::.::|..:|::.|..:::.|:.
plant    68 SLSHEARETFLSAIVGE----GRAEWLDKGHRKCLILWHRIQDWADIVLQFVRDNGLEDSVMTVE 128

  Fly   127 EIASGENTSHLDFYGVDEAVLLSALRLLEEKGRCELIEMDGS--HGVKF 173
            ||.||..:...:..|:|..:|:.||:|||.||:..|.:...:  .||||
plant   129 EIRSGTESLGTELQGIDRTILMRALKLLENKGKLALFKGTSADDEGVKF 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps25NP_610398.1 ESCRT-II 9..143 CDD:283517 43/137 (31%)
VPS25NP_001319990.1 ESCRT-II 12..139 CDD:399106 42/131 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2699
eggNOG 1 0.900 - - E1_KOG4068
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6303
Inparanoid 1 1.050 115 1.000 Inparanoid score I2027
OMA 1 1.010 - - QHG54593
OrthoDB 1 1.010 - - D1094121at2759
OrthoFinder 1 1.000 - - FOG0004660
OrthoInspector 1 1.000 - - oto3473
orthoMCL 1 0.900 - - OOG6_103180
Panther 1 1.100 - - LDO PTHR13149
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3846
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.