DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps25 and Vps25

DIOPT Version :9

Sequence 1:NP_610398.1 Gene:Vps25 / 35847 FlyBaseID:FBgn0022027 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001166922.1 Gene:Vps25 / 681059 RGDID:1584685 Length:176 Species:Rattus norvegicus


Alignment Length:172 Identity:75/172 - (43%)
Similarity:115/172 - (66%) Gaps:1/172 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FQWPWEYTFPPFFTLQPHEETRQQQLKVWTDLFLKYLRHTNRFTLSIGD-QNSPLFHNEALKRRL 67
            |:|||:|.|||||||||:.:|||:||..|..|.|.:.|...:.::::.: |.||||:|..|:|:|
  Rat     5 FEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKL 69

  Fly    68 SPELVLAILGELERSGHANPLDKRRQEWQVYWFTLEEYGNMVYDWVQETGQTNTICTLYEIASGE 132
            ..|.:..:|.||.:.|:...|||.:..:.:.|...||:|.::|.||..:||.|::.||||:.|||
  Rat    70 PVESIQIVLEELRKKGNLEWLDKNKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTSGE 134

  Fly   133 NTSHLDFYGVDEAVLLSALRLLEEKGRCELIEMDGSHGVKFF 174
            :|...:|:|:|||.||.||:.|:::.:.|:|.:....|||||
  Rat   135 DTEEEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps25NP_610398.1 ESCRT-II 9..143 CDD:283517 56/134 (42%)
Vps25NP_001166922.1 ESCRT-II 10..139 CDD:399106 54/129 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342152
Domainoid 1 1.000 125 1.000 Domainoid score I5364
eggNOG 1 0.900 - - E1_KOG4068
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6303
Inparanoid 1 1.050 166 1.000 Inparanoid score I4084
OMA 1 1.010 - - QHG54593
OrthoDB 1 1.010 - - D1094121at2759
OrthoFinder 1 1.000 - - FOG0004660
OrthoInspector 1 1.000 - - oto96619
orthoMCL 1 0.900 - - OOG6_103180
Panther 1 1.100 - - LDO PTHR13149
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3846
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.