DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps25 and vps25

DIOPT Version :9

Sequence 1:NP_610398.1 Gene:Vps25 / 35847 FlyBaseID:FBgn0022027 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001082831.2 Gene:vps25 / 407684 ZFINID:ZDB-GENE-050506-30 Length:174 Species:Danio rerio


Alignment Length:172 Identity:73/172 - (42%)
Similarity:115/172 - (66%) Gaps:1/172 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FQWPWEYTFPPFFTLQPHEETRQQQLKVWTDLFLKYLRHTNRFTLSIGD-QNSPLFHNEALKRRL 67
            |:|||:|.|||||||||:.:|||:||..|..|.|.|.||...:||.:.: |.||:|:|:.::|:|
Zfish     3 FEWPWQYNFPPFFTLQPNVDTRQKQLAAWCSLVLSYCRHRKLYTLDVLEAQESPVFNNKKIERKL 67

  Fly    68 SPELVLAILGELERSGHANPLDKRRQEWQVYWFTLEEYGNMVYDWVQETGQTNTICTLYEIASGE 132
            |.|.:..:..||.:.|:...|||.:....:.|...||:|.::|.||.:.|..|::.||||:|:|:
Zfish    68 SVEAIQVVFEELRKKGNLEWLDKNKSRCLIMWRRPEEWGKLIYQWVSKNGMVNSVFTLYELANGD 132

  Fly   133 NTSHLDFYGVDEAVLLSALRLLEEKGRCELIEMDGSHGVKFF 174
            :|...:|:|:::.:||.:|:.|:..|:.|:|.:|...|||||
Zfish   133 DTEKEEFHGLEDWMLLRSLQALQTDGKAEIITVDDGKGVKFF 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps25NP_610398.1 ESCRT-II 9..143 CDD:283517 56/134 (42%)
vps25NP_001082831.2 ESCRT-II 8..143 CDD:283517 56/134 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582195
Domainoid 1 1.000 129 1.000 Domainoid score I5231
eggNOG 1 0.900 - - E1_KOG4068
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6303
Inparanoid 1 1.050 170 1.000 Inparanoid score I4115
OMA 1 1.010 - - QHG54593
OrthoDB 1 1.010 - - D1094121at2759
OrthoFinder 1 1.000 - - FOG0004660
OrthoInspector 1 1.000 - - oto40757
orthoMCL 1 0.900 - - OOG6_103180
Panther 1 1.100 - - LDO PTHR13149
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1645
SonicParanoid 1 1.000 - - X3846
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.