DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps25 and Vps25

DIOPT Version :9

Sequence 1:NP_610398.1 Gene:Vps25 / 35847 FlyBaseID:FBgn0022027 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001271340.1 Gene:Vps25 / 28084 MGIID:106354 Length:184 Species:Mus musculus


Alignment Length:180 Identity:75/180 - (41%)
Similarity:115/180 - (63%) Gaps:9/180 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FQWPWEYTFPPFFTLQPHEETRQQQLKVWTDLFLKYLRHTNRFTLSIGD-QNSPLFHNEALKR-- 65
            |:|||:|.|||||||||:.:|||:||..|..|.|.:.|...:.::::.: |.||||:|..|:|  
Mouse     5 FEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRHS 69

  Fly    66 ------RLSPELVLAILGELERSGHANPLDKRRQEWQVYWFTLEEYGNMVYDWVQETGQTNTICT 124
                  :|..|.:..:|.||.:.|:...|||.:..:.:.|...||:|.::|.||..:||.|::.|
Mouse    70 LNLKPGKLPVESIQIVLEELRKKGNLEWLDKNKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFT 134

  Fly   125 LYEIASGENTSHLDFYGVDEAVLLSALRLLEEKGRCELIEMDGSHGVKFF 174
            |||:.|||:|...:|:|:|||.||.||:.|:::.:.|:|.:....|||||
Mouse   135 LYELTSGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps25NP_610398.1 ESCRT-II 9..143 CDD:283517 56/142 (39%)
Vps25NP_001271340.1 ESCRT-II 10..153 CDD:283517 62/151 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838363
Domainoid 1 1.000 125 1.000 Domainoid score I5484
eggNOG 1 0.900 - - E1_KOG4068
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6303
Inparanoid 1 1.050 165 1.000 Inparanoid score I4178
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54593
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004660
OrthoInspector 1 1.000 - - oto93066
orthoMCL 1 0.900 - - OOG6_103180
Panther 1 1.100 - - LDO PTHR13149
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1645
SonicParanoid 1 1.000 - - X3846
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.