DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps25 and vps-25

DIOPT Version :9

Sequence 1:NP_610398.1 Gene:Vps25 / 35847 FlyBaseID:FBgn0022027 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001379220.1 Gene:vps-25 / 173143 WormBaseID:WBGene00012193 Length:183 Species:Caenorhabditis elegans


Alignment Length:172 Identity:65/172 - (37%)
Similarity:101/172 - (58%) Gaps:2/172 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FQWPWEYTFPPFFTLQPHEETRQQQLKVWTDLFLKYLRHTNRFTLSIGD-QNSPLFHNEALKRRL 67
            |:|||:|.||||||:|....|:.:||:.|..|.:.|.:|...::|.|.: ..|.||:|:.|.|||
 Worm    11 FKWPWQYDFPPFFTIQKSLNTKDKQLEAWARLVIDYAQHNKIYSLDIAEATTSELFNNQKLNRRL 75

  Fly    68 SPELVLAILGELERSGHANPLDKRRQEWQVYWFTLEEYGNMVYDWVQETGQTNTICTLYEIASGE 132
            |.:.|..:|..||:.......|..|..:.::|...:.:.||:|.|..|....||..|||||..|:
 Worm    76 STDGVNTVLQYLEQKKLIEFTDNGRTRFHIFWRRPDVWANMIYQWAVENAFINTPLTLYEITHGD 140

  Fly   133 NTSHLDFYGVDEAVLLSALRLLEEKGRCELIEMDG-SHGVKF 173
            :|::..|:.::..:|:.||..|||:.|.:|:.:.| :.||||
 Worm   141 DTTNESFHNLEREILMKALTCLEEQRRAQLMNIGGDNEGVKF 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps25NP_610398.1 ESCRT-II 9..143 CDD:283517 48/134 (36%)
vps-25NP_001379220.1 ESCRT-II 16..145 CDD:399106 47/128 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160119
Domainoid 1 1.000 97 1.000 Domainoid score I4586
eggNOG 1 0.900 - - E1_KOG4068
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6303
Inparanoid 1 1.050 133 1.000 Inparanoid score I3175
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54593
OrthoDB 1 1.010 - - D1094121at2759
OrthoFinder 1 1.000 - - FOG0004660
OrthoInspector 1 1.000 - - oto20206
orthoMCL 1 0.900 - - OOG6_103180
Panther 1 1.100 - - LDO PTHR13149
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1645
SonicParanoid 1 1.000 - - X3846
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.