DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cirl and ADGRG1

DIOPT Version :9

Sequence 1:NP_001260807.1 Gene:Cirl / 35846 FlyBaseID:FBgn0033313 Length:1711 Species:Drosophila melanogaster
Sequence 2:XP_005256294.1 Gene:ADGRG1 / 9289 HGNCID:4512 Length:698 Species:Homo sapiens


Alignment Length:431 Identity:106/431 - (24%)
Similarity:168/431 - (38%) Gaps:126/431 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   661 AGEIQQRL-----------------RILNSKVISASLGKGRHIQLSQPITLTLKH-LKTENVTNP 707
            :||.::||                 ::|..||:...:...:...|::|:.||.:| |:.:||| .
Human   286 SGEAEKRLLLVDFSSQALFQDKNSSQVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNVT-L 349

  Fly   708 TCVFW------NYIDHAWSANGCSLESTNR-THSVCSCNHLTNFAILM------DVVDEHQHSLF 759
            .||||      :...| ||:.||  |:..| |.:.|.|||||.||:||      |.|.:|..||.
Human   350 QCVFWVEDPTLSSPGH-WSSAGC--ETVRRETQTSCFCNHLTYFAVLMVSSVEVDAVHKHYLSLL 411

  Fly   760 TMFDGNMRIFIYISIGICVVFIVIALLTLKLFNGVFVKSARTSIYTSIYLC-------------- 810
            :          |:.   |||..:..|:|:                 :.|||              
Human   412 S----------YVG---CVVSALACLVTI-----------------AAYLCSRVPLPCRRKPRDY 446

  Fly   811 --------LLAIELL---FLLG--IEQTETSIFCGFITIFLHCAILSGTAWFCYEAFHSYSTLTS 862
                    |||:.||   |||.  :..|.:...|....||||.::|:..:|...|.::.|     
Human   447 TIKVHMNLLLAVFLLDTSFLLSEPVALTGSEAGCRASAIFLHFSLLTCLSWMGLEGYNLY----- 506

  Fly   863 DELLLEVDQTPKVNCYYL----LSYGLSLSVVAISLVIDPSTYTQNDYCVLMEANALFYAT--FV 921
             .|::||..| .|..|.|    :.:|..:.:|.:..::|...|......|......:.|.:  ::
Human   507 -RLVVEVFGT-YVPGYLLKLSAMGWGFPIFLVTLVALVDVDNYGPIILAVHRTPEGVIYPSMCWI 569

  Fly   922 IPVLVFFVAAIGYTFLSWIIMCRKSRTG----LKTKEHTRLASVRFDIRCSFVFLLL-LSAV--- 978
            ...||.::..:|...|.::.......|.    |:.:.||:        :.|.|..|| ||.|   
Human   570 RDSLVSYITNLGLFSLVFLFNMAMLATMVVQILRLRPHTQ--------KWSHVLTLLGLSLVLGL 626

  Fly   979 -WCSAYFYLRGAKMDDDTADVYGYCFICFNTLLGLYIFVFH 1018
             |...:|........    .|..|.|....:..|..||:::
Human   627 PWALIFFSFASGTFQ----LVVLYLFSIITSFQGFLIFIWY 663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CirlNP_001260807.1 Gal_Lectin 33..113 CDD:280328
GAIN 453..680 CDD:293098 7/35 (20%)
GPS 705..752 CDD:197639 24/59 (41%)
7tm_4 763..1014 CDD:304433 61/292 (21%)
ADGRG1XP_005256294.1 GPS 349..393 CDD:280071 20/46 (43%)
7tm_4 408..659 CDD:304433 63/299 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.