DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cirl and EVA1C

DIOPT Version :9

Sequence 1:NP_001260807.1 Gene:Cirl / 35846 FlyBaseID:FBgn0033313 Length:1711 Species:Drosophila melanogaster
Sequence 2:NP_478067.2 Gene:EVA1C / 59271 HGNCID:13239 Length:441 Species:Homo sapiens


Alignment Length:153 Identity:41/153 - (26%)
Similarity:59/153 - (38%) Gaps:32/153 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CEGKKLTIECDPGDVINLIRANYGRFS--ITICNDHGNVEWSVNCMFPKSLSVLNSRCAHKQSCG 88
            ||.::|.:.|.....:|:..|.|||.:  ..||:.........:|:...:|.||:.||..||.|.
Human   169 CEDQELKLHCHESKFLNIYSATYGRRTQERDICSSKAERLPPFDCLSYSALQVLSRRCYGKQRCK 233

  Fly    89 VLAATSMFGDPC-PGTHKYLEAHYQCISAAQTSTTTNRPSPPPWVLSNGPPIFGNGSGLIHPPGV 152
            ::.....||.|| ||..|||...|.|:              |..:|:...|...|          
Human   234 IIVNNHHFGSPCLPGVKKYLTVTYACV--------------PKNILTAIDPAIAN---------- 274

  Fly   153 GAGAPPPPRLPTLPGVVGISGNP 175
                 ..|.|....|..||:.:|
Human   275 -----LKPSLKQKDGEYGINFDP 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CirlNP_001260807.1 Gal_Lectin 33..113 CDD:280328 27/82 (33%)
GAIN 453..680 CDD:293098
GPS 705..752 CDD:197639
7tm_4 763..1014 CDD:304433
EVA1CNP_478067.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Gal_Lectin 75..158 CDD:280328
Gal_Lectin 176..259 CDD:280328 27/82 (33%)
FAM176 301..441 CDD:291517
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 362..390
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4729
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.