DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cirl and si:ch211-226h8.11

DIOPT Version :10

Sequence 1:NP_001260807.1 Gene:Cirl / 35846 FlyBaseID:FBgn0033313 Length:1711 Species:Drosophila melanogaster
Sequence 2:NP_001103856.1 Gene:si:ch211-226h8.11 / 561329 ZFINID:ZDB-GENE-050208-629 Length:155 Species:Danio rerio


Alignment Length:95 Identity:39/95 - (41%)
Similarity:50/95 - (52%) Gaps:4/95 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TAYACEGKKLTIECDPGDVINLIRANYGRFSITIC---NDHGNVEWSVNCMFPKSLSVLNSRCAH 83
            |..||||..|.:.|.....|.::.|||||.....|   ...|.:. :.||....|||:::|.|..
Zfish    57 TVTACEGSILRLSCPVYSKIRVLAANYGRTDRKTCIKNRPPGEIR-NTNCRSSSSLSIVSSWCDG 120

  Fly    84 KQSCGVLAATSMFGDPCPGTHKYLEAHYQC 113
            :|||.|.|..|:|.|||.||:|||...|.|
Zfish   121 RQSCNVPATNSVFSDPCYGTYKYLAVKYCC 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CirlNP_001260807.1 Gal_Rha_Lectin_dCirl 22..113 CDD:438687 38/93 (41%)
GAIN 451..682 CDD:465137
GPS 705..752 CDD:197639
7tmB2_CELSR_Adhesion_IV 763..1035 CDD:320557
TM helix 1 765..790 CDD:320557
TM helix 2 801..823 CDD:320557
TM helix 3 832..859 CDD:320557
TM helix 4 875..895 CDD:320557
TM helix 5 913..942 CDD:320557
TM helix 6 960..987 CDD:320557
TM helix 7 997..1022 CDD:320557
Herpes_TAF50 <1219..1365 CDD:308764
si:ch211-226h8.11NP_001103856.1 Gal_Rha_Lectin 56..150 CDD:459238 38/93 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.