DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cirl and zgc:136410

DIOPT Version :9

Sequence 1:NP_001260807.1 Gene:Cirl / 35846 FlyBaseID:FBgn0033313 Length:1711 Species:Drosophila melanogaster
Sequence 2:NP_001035384.1 Gene:zgc:136410 / 449685 ZFINID:ZDB-GENE-060421-6071 Length:222 Species:Danio rerio


Alignment Length:116 Identity:36/116 - (31%)
Similarity:56/116 - (48%) Gaps:21/116 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLPTILSISYEHISLDLSKYQTAYACEGKKLTIECDPGDVINLIRANYGRFSITICN---DHGNV 62
            ::||:                |...|||..|.:.||.| .|::..|||||.....|:   ....|
Zfish    18 LIPTV----------------TVNTCEGSVLHLNCDTG-TIHITAANYGRTDKITCSAGRPFNEV 65

  Fly    63 EWSVNCMFPKSLSVLNSRCAHKQSCGVLAATSMFGDPCPGTHKYLEAHYQC 113
            ::: ||..|.:|::::..|..::.|.|..:..:|.|||.||:|||...|.|
Zfish    66 QYT-NCHTPSALAIVSQSCNGRKICDVSVSNEVFTDPCFGTYKYLSTLYSC 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CirlNP_001260807.1 Gal_Lectin 33..113 CDD:280328 28/82 (34%)
GAIN 453..680 CDD:293098
GPS 705..752 CDD:197639
7tm_4 763..1014 CDD:304433
zgc:136410NP_001035384.1 Gal_Lectin 34..115 CDD:280328 28/82 (34%)
Gal_Lectin 133..215 CDD:280328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.