DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cirl and mthl7

DIOPT Version :9

Sequence 1:NP_001260807.1 Gene:Cirl / 35846 FlyBaseID:FBgn0033313 Length:1711 Species:Drosophila melanogaster
Sequence 2:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster


Alignment Length:290 Identity:65/290 - (22%)
Similarity:102/290 - (35%) Gaps:81/290 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   744 FAILMDVVDEHQ------HSLFTMFDGNM-----RIFIYISIG---------ICVVFIVIALLTL 788
            |.:.:|:..|.|      |:..:.|..:|     |...:||.|         ||.|..:...|.:
  Fly   179 FWVTVDLFMEKQDYCLYRHNFDSDFPKSMWIIRHRC
TSHISPGSLEILIITMICFVLTIAVYLYI 243

  Fly   789 KLFNGVFVKSARTSIYTSIYLCLLAI--ELLFLLGIEQTETSIFCGFITIFLHCAILSGTAWFCY 851
            |....|..|.....|.:....||:.|  .|..|.||        |.......|...::...|...
  Fly   244 KKLRNVTGKCIVCCIVSRFIQCLIMILDHLNLLNGI--------CSPAGYSSHFFRMASNLWLSV 300

  Fly   852 EAFHSYSTLTSDELLLEVDQTPKVNCYYLLSYGLSL-SVVAI---SLVI-------DPSTY---- 901
            .::|::..|||   |..||..     |..|.|...: |..||   |:.|       |||.:    
  Fly   301 ISYHTWKVLTS---LNRVDPN-----YRFLRYNAFVWSTAAIMTGSIYIVNQIWENDPSKWNWLP 357

  Fly   902 -------TQNDY----CVLMEANALFYATFVIPVLVFFVAAIGYTFLSWIIMCRKSRTGLK---T 952
                   :..|:    .:.:...:|..:||  .|.:|.:.|         |..||.:.|:.   .
  Fly   358 LVGFIRCSVKDWHPSVWIYISGPSLALSTF--NVAMFALTA---------IYIRKVKGGINKFTN 411

  Fly   953 KEHTRLASVRFDIRCSFVFL---LLLSAVW 979
            :|..|:..:.||.:....||   :::...|
  Fly   412 EEEGRINCINFDSQTYLQFLRLSIVMGLTW 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CirlNP_001260807.1 Gal_Lectin 33..113 CDD:280328
GAIN 453..680 CDD:293098
GPS 705..752 CDD:197639 2/7 (29%)
7tm_4 763..1014 CDD:304433 59/265 (22%)
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804 7/34 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462226
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.