DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cirl and mthl2

DIOPT Version :9

Sequence 1:NP_001260807.1 Gene:Cirl / 35846 FlyBaseID:FBgn0033313 Length:1711 Species:Drosophila melanogaster
Sequence 2:NP_788462.2 Gene:mthl2 / 38636 FlyBaseID:FBgn0035623 Length:518 Species:Drosophila melanogaster


Alignment Length:402 Identity:76/402 - (18%)
Similarity:139/402 - (34%) Gaps:127/402 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   749 DVVDEH------------------------QHSLFTMFDGN---MRIF---------------IY 771
            |::||:                        ||..|.  :||   :||.               :.
  Fly   162 DIMDEYTLFENGRLLRHYDQVYLDKSEYCLQHRTFG--EGNNNSIRIIPHNC
LILPSRTGQTVVM 224

  Fly   772 ISIGICVVF-IVIALLTLKLFN---GVFVKSARTSIYTSIYLCLLAIELLFLLGIEQTETSI-FC 831
            |:..||:|. |.:.|...||.|   ..|:          .|:..|....|||| ::..|.|: ||
  Fly   225 ITSLICLVLTIAVYLCVKKLMNLEGKCFI----------CYMMCLFFGYLFLL-LDLWELSLDFC 278

  Fly   832 ---GFITIFLHCAILSGTAWFCYEAFHSYSTLTSDELLLEVDQTPKVNCYYLLSYGLSLSVVAIS 893
               ||:..|.   :::...|....:.|.:..||:....:.:........|...::.:.|::..::
  Fly   279 KAAGFLGYFF---VMAAFFWLSIISRHYWKCLTNPCASMNIRSERAFLLYSCFAWAMPLALTGVT 340

  Fly   894 LVIDPSTYTQND--------------YCVLMEANALFYATFVIPVLVFFVAAIGYTFLSWIIMCR 944
            .:.|  ....|:              |.....|...||...|:  |:.|...:.......||..:
  Fly   341 YLAD--NVVNNEEWQPRVGDEGHCWIYTKSWSAMVYFYGPMVL--LILFNITMFVLTAKHIIDSK 401

  Fly   945 KSRTGLKTKEHTRLASVRFDIRCSFVFLLLLSAVWCSAYFYLRGAKMDDDTADVYGY-------- 1001
            ::...:...| .|:..:..|.:....||||.:.:..|..|            :::.|        
  Fly   402 RTLRKIARNE-GRIQKLNSDKQNYTQFLLLFTVMGMSWSF------------EIFSYLVQREKLW 453

  Fly  1002 --CFIC---FNTLLGLYIFVFHCIQNEKIRREYRKYVRQHAWLPKCLRCSKTSISSGIVTGNGPT 1061
              .|:.   ||...|:.|||...::.:.:.. ::|.:     .||....|:::           |
  Fly   454 VNIFLVADYFNWSQGVIIFVLFILRRKTLVL-FKKQI-----FPKQRAFSRSA-----------T 501

  Fly  1062 AGTLCSVSTSKK 1073
            ..|:.|:|.:|:
  Fly   502 QSTIESISQTKR 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CirlNP_001260807.1 Gal_Lectin 33..113 CDD:280328
GAIN 453..680 CDD:293098
GPS 705..752 CDD:197639 1/2 (50%)
7tm_4 763..1014 CDD:304433 58/303 (19%)
mthl2NP_788462.2 Methuselah_N 31..211 CDD:284145 10/50 (20%)
7tm_4 221..>395 CDD:304433 38/191 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.