DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cirl and mthl8

DIOPT Version :9

Sequence 1:NP_001260807.1 Gene:Cirl / 35846 FlyBaseID:FBgn0033313 Length:1711 Species:Drosophila melanogaster
Sequence 2:NP_001261182.1 Gene:mthl8 / 38013 FlyBaseID:FBgn0052475 Length:492 Species:Drosophila melanogaster


Alignment Length:318 Identity:59/318 - (18%)
Similarity:95/318 - (29%) Gaps:124/318 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   789 KLFNGVFVKSARTSIYTSIYLCLLA------IELLFLLGIEQTETSIFCGFITIFLHCAILSGTA 847
            ||:   ||...|...|.   :|||.      |.|:..|...:...|.:...|..:..|.|| |.|
  Fly   206 KLY---FVLGVREWTYA---ICLLIAILSMFIVLMVYLMCSEMRNSFYGVAIKAYAICMIL-GYA 263

  Fly   848 WFCYEAFHSYSTLTSD--ELLLEVDQTPKVNCYYLLS----------YGLSLSVVAISLVIDP-- 898
            ...|...|:.:.|::.  .:|..:.....|..:|:||          ||:..:.:...|:..|  
  Fly   264 LLAYLTLHNPANLSNAACRILPSLALMNLVLSFYILSFIAFKLYLSFYGVVFTKLMFWLIFTPIV 328

  Fly   899 ------------STYTQ-----NDYCVLMEANALFYATFVIPVLV-------FFVAA-------- 931
                        |.|..     .|.|.....|......|..||.|       |:|.:        
  Fly   329 LVAVGWSFFVGFSYYGSRLIFGGDTCWFDPRNWSVMIYFYAPVFVACAISGFFYVLSQIYIRDQP 393

  Fly   932 ----------------------IGYTFLSWIIMCRKSRTGLKTKEHTRLASVRFDIRCSFVFLLL 974
                                  .|||.:.|::..                       |||.|   
  Fly   394 DIETEKSFESIEKNRFKSFWKYFGYTAVVWVVCI-----------------------CSFAF--- 432

  Fly   975 LSAVWCSAYFYLRGAKMDDDTADVYGYCF-ICFNTLLGLYIFVFHCIQNEKIRREYRK 1031
                   .|::...:.::      |...| :.|:....||..:.   :|::|:...|:
  Fly   433 -------NYYWENRSHLN------YAVSFCMAFHGFAALYALIG---KNQQIQNFLRR 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CirlNP_001260807.1 Gal_Lectin 33..113 CDD:280328
GAIN 453..680 CDD:293098
GPS 705..752 CDD:197639
7tm_4 763..1014 CDD:304433 55/299 (18%)
mthl8NP_001261182.1 Methuselah_N 30..202 CDD:284145
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462192
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.