DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cirl and mthl3

DIOPT Version :9

Sequence 1:NP_001260807.1 Gene:Cirl / 35846 FlyBaseID:FBgn0033313 Length:1711 Species:Drosophila melanogaster
Sequence 2:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster


Alignment Length:497 Identity:92/497 - (18%)
Similarity:169/497 - (34%) Gaps:177/497 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   633 PSYDHFDLKSSRSYVRNTAILSNDSDVNAGEIQQRLRILNSKVISASLGKGRHIQLSQPITLTLK 697
            |.|.  .::.|:.|          .|::..|:.:     :...::.:|..|         ::..:
  Fly    93 PQYQ--KMQKSKCY----------GDMSEDELNK-----HDPFVNVTLSDG---------SVVRR 131

  Fly   698 HLKTE-----NVTNPTCVFWNYIDHAWSANGCSL-------------ESTNRTHSVCSCNHLT-- 742
            |.|.:     ::..|.|....:::|....|..:|             |.:.|.:.|   .||:  
  Fly   132 HFKEDLIVQSDLAKPGCPRMYFLNHELPGNEFTLFENGSLLRHWDKVELSKREYCV---QHLSFK 193

  Fly   743 --------NFAILMDVVDEHQHSLFTMFDGNMRIFIYISIGICVVFIVIALLTLKLFNGVFVKSA 799
                    :|..|.   .||..:..|       :.|.||: ||::      ||:.::  ::|:..
  Fly   194 DDSIRIAPHFCPLS---SEHSRTWKT-------VAIVISL-ICII------LTISVY--LYVEKL 239

  Fly   800 RTSIYTSIYLCLLA---IELLFLLGIEQTETSIFC---GF------ITIFLHCAILSGTAWFCYE 852
            | :::...::|.||   :...||:......:|.||   ||      |..|...:::|.|.|..:.
  Fly   240 R-NLHGKCFICYLASLFLGYFFLVLNVWKYSSGFCVTAGFLGYFSVIAAFFWLSVISLTLWNSFS 303

  Fly   853 AFHSYST--LTSDELLLEVDQTPKVNCYYLLSYGLSLSVVAISLVIDPST--------------- 900
            ...|:..  |..:..|          .|.|.::|::|.:.||:.:.|...               
  Fly   304 GNSSWLNRFLPQNRFL----------SYNLYAWGMALLLTAITYIADQVVKNEKLRPRVGVGKNC 358

  Fly   901 --YTQNDYCVLMEANALFYATFVIPVLVFFVAAIGYTFLSWIIMCRKSRTGLKTKEHT--RLASV 961
              || .|..|::    .||...:: ::||.:.....|... |:..:|.......::.|  ||.|.
  Fly   359 WIYT-GDMTVMI----YFYGPMLL-IIVFNITMFVLTAFR-IMKVKKEAQNFTQQQKTTNRLNSD 416

  Fly   962 R----FDIRCSFV-----------FLLLLSAVWCSAYFYLRGAKMDDDTADVYGYCFICFNTLLG 1011
            :    ..:|...:           |||..:..|..|:.          .||.       ||...|
  Fly   417 KQTYALFLRLFIIMGLSWSLEIISFLLSKNQAWAKAFM----------VADY-------FNWSQG 464

  Fly  1012 LYIFVFHCIQNEKIRREYRKYVRQHAWLPKCLRCSKTSISSG 1053
            ..||:...::                  |..|:..|..|..|
  Fly   465 TVIFLLFVLR------------------PSTLKLLKERIKGG 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CirlNP_001260807.1 Gal_Lectin 33..113 CDD:280328
GAIN 453..680 CDD:293098 6/46 (13%)
GPS 705..752 CDD:197639 12/69 (17%)
7tm_4 763..1014 CDD:304433 60/298 (20%)
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145 20/139 (14%)
7tm_4 216..436 CDD:304433 51/253 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.