DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cirl and Dh44-R2

DIOPT Version :9

Sequence 1:NP_001260807.1 Gene:Cirl / 35846 FlyBaseID:FBgn0033313 Length:1711 Species:Drosophila melanogaster
Sequence 2:NP_610789.3 Gene:Dh44-R2 / 36368 FlyBaseID:FBgn0033744 Length:476 Species:Drosophila melanogaster


Alignment Length:347 Identity:64/347 - (18%)
Similarity:136/347 - (39%) Gaps:75/347 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   723 GCSLESTNRTHSVCSCN----HLTNFAILMDVVDE-HQHS----LFTMFDGNMRIFIYISIG--- 775
            |...::|:.....|..|    |.:::       |. ||:|    :...|..|:.:...|..|   
  Fly   113 GVHYDTTDNATRFCFPNGTWDHYSDY-------DRCHQN
SGSIPVVPDFSPNVELPAIIYAGGYF 170

  Fly   776 ICVVFIVIALLTLKLFNGVFVKSARTSIYTSIYL-----CLLAIELLFLLGIEQTETSIFCGFIT 835
            :....:|:||:....|..  ::..|.:|:.:::|     .||.|..|||..|....:...|..:.
  Fly   171 LSFATLVVALIIFLSFKD--LRCLRNTIHANLFLTYITSALLWILTLFLQVITTESSQAGCITLV 233

  Fly   836 IFLHCAILSGTAWFCYEAFHSYS----TLTSDELLLEVDQTPKVNCYYLLSYG---LSLSVVAIS 893
            |......|:...|...|..:.|:    |.:||.:...:        |.|:.:|   :.:.|.:|:
  Fly   234 IMFQYFYLTNFFWMFVEGLYLYTLVVQTFSSDNISFII--------YALIGWGCPAVCILVWSIA 290

  Fly   894 LVIDPSTYTQNDY-------CVLMEANALFYATFVIPV-------LVFFVAAIGYTFLSWIIMCR 944
            ....|  :.:|::       |..|..:.:.: .|.:|.       |||.:.      :.|:::.:
  Fly   291 KAFAP--HLENEHFNGLEIDCAWMRESHIDW-IFKVPASLALLVNLVFLIR------IMWVLITK 346

  Fly   945 -KSRTGLKTKEHTRLASVRFDIRCSFVFLLLLSAVWCSAYFYLRGAKMDDDTADVYGYCFICFNT 1008
             :|...|:|:::.:.:..          ||:|..::...|..:........:.:::........:
  Fly   347 LRSAHTLETRQYYKASKA----------LLVLIPLFGITYLLVLTGPEQGISRNLFEAIRAFLIS 401

  Fly  1009 LLGLYIFVFHCIQNEKIRREYR 1030
            ..|.::.:|:|..|.::|:..|
  Fly   402 TQGFFVALFYCFLNSEVRQTLR 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CirlNP_001260807.1 Gal_Lectin 33..113 CDD:280328
GAIN 453..680 CDD:293098
GPS 705..752 CDD:197639 5/32 (16%)
7tm_4 763..1014 CDD:304433 49/280 (18%)
Dh44-R2NP_610789.3 HRM 82..144 CDD:280888 7/37 (19%)
7tm_2 159..407 CDD:278432 48/276 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462222
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.