DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cirl and LOC100331830

DIOPT Version :10

Sequence 1:NP_001260807.1 Gene:Cirl / 35846 FlyBaseID:FBgn0033313 Length:1711 Species:Drosophila melanogaster
Sequence 2:NP_001352889.1 Gene:LOC100331830 / 100331830 -ID:- Length:128 Species:Danio rerio


Alignment Length:116 Identity:42/116 - (36%)
Similarity:59/116 - (50%) Gaps:9/116 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LPTILSISYEHISLDLSKYQT--AYACEGKKLTIECDPGDVINLIRANYGRFSITICND--HGNV 62
            |.:||.||.:    |..|..|  |.|||...|.:.|....||.::.|||||.....|.:  :|.:
Zfish    13 LNSILLISAD----DYCKRSTDIATACEHSVLDLSCPDHTVIKILAANYGRTERRSCRNRPYGQL 73

  Fly    63 EWSVNCMFPKSLSVLNSRCAHKQSCGVLAATSMFGDPCPGTHKYLEAHYQC 113
            . ..:|..|.::.::..||..::.|.|.|..|:|.|||.||:|||...|.|
Zfish    74 R-DTHCYTPNAVFIVGRRCNWRKRCSVPATNSVFSDPCVGTYKYLRVKYCC 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CirlNP_001260807.1 Gal_Rha_Lectin_dCirl 22..113 CDD:438687 34/94 (36%)
GAIN 451..682 CDD:465137
GPS 705..752 CDD:197639
7tmB2_CELSR_Adhesion_IV 763..1035 CDD:320557
TM helix 1 765..790 CDD:320557
TM helix 2 801..823 CDD:320557
TM helix 3 832..859 CDD:320557
TM helix 4 875..895 CDD:320557
TM helix 5 913..942 CDD:320557
TM helix 6 960..987 CDD:320557
TM helix 7 997..1022 CDD:320557
Herpes_TAF50 <1219..1365 CDD:308764
LOC100331830NP_001352889.1 Gal_Rha_Lectin_SUL-I-like 32..123 CDD:438684 33/91 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.