DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cirl and si:ch73-189n23.1

DIOPT Version :9

Sequence 1:NP_001260807.1 Gene:Cirl / 35846 FlyBaseID:FBgn0033313 Length:1711 Species:Drosophila melanogaster
Sequence 2:NP_001103315.1 Gene:si:ch73-189n23.1 / 100126117 ZFINID:ZDB-GENE-070705-217 Length:139 Species:Danio rerio


Alignment Length:107 Identity:39/107 - (36%)
Similarity:54/107 - (50%) Gaps:7/107 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YEHISLDLSKYQTAYACEGKKLTIECDPGDV-INLIRANYGRFSITICNDHGNVEW--SVNCMFP 71
            |||.....:   :..||||..|.:.| ||.. |.::.|||||.....||.:.:...  :.||...
Zfish    32 YEHCRRSTN---SVTACEGSVLRLSC-PGHAKIKILAANYGRTDKKTCNINLSPRQVRNTNCRSS 92

  Fly    72 KSLSVLNSRCAHKQSCGVLAATSMFGDPCPGTHKYLEAHYQC 113
            .||..:::||..::||.|.|...:|.||||..:|||...|.|
Zfish    93 NSLPRVSARCDGRESCYVPATNGVFSDPCPRIYKYLTVKYCC 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CirlNP_001260807.1 Gal_Lectin 33..113 CDD:280328 30/82 (37%)
GAIN 453..680 CDD:293098
GPS 705..752 CDD:197639
7tm_4 763..1014 CDD:304433
si:ch73-189n23.1NP_001103315.1 Gal_Lectin 52..134 CDD:280328 30/82 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4729
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.