DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and FCN3

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_003656.2 Gene:FCN3 / 8547 HGNCID:3625 Length:299 Species:Homo sapiens


Alignment Length:224 Identity:87/224 - (38%)
Similarity:120/224 - (53%) Gaps:28/224 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 DLLADWEAATTS-----CVPFGRSPGIHLIHLPGFLPFLVPCEGQTAAGPGWTCIQRRLDGSVNF 256
            :||:  :.||.|     |:|.||:       ||.|      |:..|..| ||...|||.||||:|
Human    95 ELLS--QGATLSGWYHLCLPEGRA-------LPVF------CDMDTEGG-GWLVFQRRQDGSVDF 143

  Fly   257 YRNWDAYSKGFGKLNGEFFIGLEKLHRLTSSQPHELYISIRRFGGETSYAHYDDFLIGSEEEGYE 321
            :|:|.:|..|||....||::|.|.||:||.....||.:.:..|.|..::|||..|.:..|.:.|:
Human   144 FRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQ 208

  Fly   322 LKLLGHYQGNASDALRTHDKMKFSTYDRDNDAFTHMNCAEHHQGAWWYDFCSRSNLNGRYFKGEV 386
            |.|....:|.|.|:|..|....|:|||.|:|: ::.|||....|||||..|.||||||||...|.
Human   209 LALGKFSEGTAGDSLSLHSGRPFTTYDADHDS-SNSNCAVIVHGAWWYASCYRSNLNGRYAVSEA 272

  Fly   387 DNPQSIYWEPWYSFRSL----KSVQMLIR 411
            ...:  |...|.|.|.:    :.|:|::|
Human   273 AAHK--YGIDWASGRGVGHPYRRVRMMLR 299

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352
FReD 213..413 CDD:238040 80/203 (39%)
FCN3NP_003656.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..81
FReD 90..299 CDD:238040 86/222 (39%)