DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and Fgl2

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_445907.2 Gene:Fgl2 / 84586 RGDID:620170 Length:429 Species:Rattus norvegicus


Alignment Length:379 Identity:120/379 - (31%)
Similarity:170/379 - (44%) Gaps:83/379 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LQTKDQTG--DELLRKFENLTQVCSAQQSSFTTAIKEKDE---------------QIKELEQKVK 150
            ||...|.|  :|:|::...|.:...:.:.|......:.||               :::|||.:|.
  Rat    64 LQLPQQFGSMEEVLKEVRTLQEAVDSLKKSCQDCKLQADEHPDPGGNGAETAEDNRVQELESQVN 128

  Fly   151 VYETRLKRKQHVLAELRKLNGS-SALLIEHLKGKVVYFERKFREKKDDLLADWEAATTSCV---- 210
            ...:.||..:.   |::.|.|. .:|.:.::.....|.:.|..    :|.:...:..:.|.    
  Rat   129 KLSSELKNAKE---EIQGLQGRLESLQLVNMNNIENYVDNKVA----NLTSVVNSLDSKCFKCPS 186

  Fly   211 -----PFGRSPGIHLIH-------------------LPGF--LPFLVPCEGQTAAGPGWTCIQRR 249
                 |   :|..|||:                   .|..  ..|.|.|:.:|..| |||.:|.|
  Rat   187 QEHNQP---NPVQHLIYKDCSDYYVLGKRSSGTYRVTPDHRNSSFEVYCDMETTGG-GWTVLQAR 247

  Fly   250 LDGSVNFYRNWDAYSKGFGKLNGEFFIGLEKLHRLTSSQPHELYISIRRFGGETSYAHYDDFLIG 314
            ||||.||.|.|..|..|||.|..||::|.:|:|.||.|:...|.|.:..|.|.|.||.||.|.:.
  Rat   248 LDGSTNFTRGWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFNGLTLYAVYDQFYVA 312

  Fly   315 SEEEGYELKLLGHYQGNASDALR-----THDKMKFSTYDRDNDAFTHMNCAEHHQGAWWYDFCSR 374
            :|...|.|. ||:|.|.|.||||     .||...|:|.|||||.:...||..::...||:|.|..
  Rat   313 NEFLKYRLH-LGNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSGNCGLYYSSGWWFDACLS 376

  Fly   375 SNLNGRY----FKGEVDNPQSIYWEPW----------YSFRSLKSVQMLIRPKS 414
            :||||:|    :|| |.|  .|:|..|          |.| |.|..:|:|||||
  Rat   377 ANLNGKYYHQRYKG-VRN--GIFWGTWPGVSQAHPGGYKF-SFKKAKMMIRPKS 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352 16/76 (21%)
FReD 213..413 CDD:238040 92/239 (38%)
Fgl2NP_445907.2 ApoLp-III_like <71..177 CDD:304399 20/112 (18%)
Fibrinogen_C 199..425 CDD:278572 89/231 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.