DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and ANGPTL6

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_011526650.1 Gene:ANGPTL6 / 83854 HGNCID:23140 Length:537 Species:Homo sapiens


Alignment Length:210 Identity:88/210 - (41%)
Similarity:117/210 - (55%) Gaps:35/210 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 GIHLIHLPGFLPFLVPCEGQTAAGPGWTCIQRRLDGSVNFYRNWDAYSKGFGKLNGEFFIGLEKL 281
            |.|::.        |.||.|...| |||.||||.||||||:..|..|..|||:.:||:::|||.:
Human   346 GRHVVS--------VWCEQQLEGG-GWTVIQRRQDGSVNFFTTWQHYKAGFGRPDGEYWLGLEPV 401

  Fly   282 HRLTSSQPHELYISIRRFGGETSYAHYDDFLIGSEEEGYELKLLGHYQGNASDALRTHDKMKFST 346
            ::|||...|||.:.:..:||..:.||||.|.:..|.:.|.|: ||.|.|:|.|:|..|:...|||
Human   402 YQLTSRGDHELLVLLEDWGGRGARAHYDGFSLEPESDHYRLR-LGQYHGDAGDSLSWHNDKPFST 465

  Fly   347 YDRDNDAFTHMNCAEHHQGAWWYDFCSRSNLNG----------RYFKGEVDNPQSIYWEPWYSFR 401
            .|||.|:::. |||.:.:|.|||..|:.|||||          ||..|       :||.   .||
Human   466 VDRDRDSYSG-NCALYQRGGWWYHACAHSNLNGVWHHGGHYRSRYQDG-------VYWA---EFR 519

  Fly   402 ----SLKSVQMLIRP 412
                ||:...|||||
Human   520 GGAYSLRKAAMLIRP 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352
FReD 213..413 CDD:238040 88/210 (42%)
ANGPTL6XP_011526650.1 FReD 322..535 CDD:238040 88/210 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.