Sequence 1: | NP_610396.2 | Gene: | CG8642 / 35845 | FlyBaseID: | FBgn0033312 | Length: | 429 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011526650.1 | Gene: | ANGPTL6 / 83854 | HGNCID: | 23140 | Length: | 537 | Species: | Homo sapiens |
Alignment Length: | 210 | Identity: | 88/210 - (41%) |
---|---|---|---|
Similarity: | 117/210 - (55%) | Gaps: | 35/210 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 217 GIHLIHLPGFLPFLVPCEGQTAAGPGWTCIQRRLDGSVNFYRNWDAYSKGFGKLNGEFFIGLEKL 281
Fly 282 HRLTSSQPHELYISIRRFGGETSYAHYDDFLIGSEEEGYELKLLGHYQGNASDALRTHDKMKFST 346
Fly 347 YDRDNDAFTHMNCAEHHQGAWWYDFCSRSNLNG----------RYFKGEVDNPQSIYWEPWYSFR 401
Fly 402 ----SLKSVQMLIRP 412 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8642 | NP_610396.2 | GluZincin | 72..>163 | CDD:301352 | |
FReD | 213..413 | CDD:238040 | 88/210 (42%) | ||
ANGPTL6 | XP_011526650.1 | FReD | 322..535 | CDD:238040 | 88/210 (42%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2579 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X25 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |