DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and Fcna

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_112638.2 Gene:Fcna / 83517 RGDID:621221 Length:335 Species:Rattus norvegicus


Alignment Length:197 Identity:88/197 - (44%)
Similarity:117/197 - (59%) Gaps:3/197 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 GIHLIHLPGFLPFLVPCEGQTAAGPGWTCIQRRLDGSVNFYRNWDAYSKGFGKLNGEFFIGLEKL 281
            |.:.|:||...|..|.|: ....|.|||..|||:|||:||||:||:|.:|||.|..||::|.:.|
  Rat   138 GWYTIYLPDCRPLTVLCD-MDVDGGGWTVFQRRVDGSINFYRDWDSYKRGFGNLGTEFWLGNDYL 201

  Fly   282 HRLTSSQPHELYISIRRFGGETSYAHYDDFLIGSEEEGYELKLLGHYQGNASDALRTHDKMKFST 346
            |.||::...||.:.:|.|.|:||:|.|..|.:..|:|.|:|.|....:|.|.|:|..|:.|.|||
  Rat   202 HLLTANGNQELRVDLREFQGQTSFAKYSSFQVSGEQEKYKLTLGQFLEGTAGDSLTKHNNMAFST 266

  Fly   347 YDRDNDAFTHMNCAEHHQGAWWYDFCSRSNLNGRYFKGEVDN-PQSIYWEPWYSFR-SLKSVQML 409
            :|:|||.....|||....|||||..|.:|||||||..|..:: ...|.|......| |.|..:|.
  Rat   267 HDQDNDTNGGKNCAALFHGAWWYHDCHQSNLNGRYLPGSHESYADGINWLSGRGHRYSYKVAEMK 331

  Fly   410 IR 411
            ||
  Rat   332 IR 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352
FReD 213..413 CDD:238040 88/197 (45%)
FcnaNP_112638.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..114
Collagen <67..108 CDD:396114
FReD 123..333 CDD:238040 86/195 (44%)
A domain, contributes to trimerization. /evidence=ECO:0000250 123..162 8/24 (33%)
B domain, contributes to trimerization. /evidence=ECO:0000250 163..251 41/87 (47%)
Carbohydrate-binding. /evidence=ECO:0000250|UniProtKB:O00602 291..293 0/1 (0%)
P domain. /evidence=ECO:0000250|UniProtKB:O00602 326..335 4/8 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm12326
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.710

Return to query results.
Submit another query.