DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and Angptl1

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001102853.1 Gene:Angptl1 / 679942 RGDID:1598128 Length:300 Species:Rattus norvegicus


Alignment Length:290 Identity:58/290 - (20%)
Similarity:103/290 - (35%) Gaps:71/290 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LILIMLPSAWCLQVPSKIKSTTKAPVKEIP-PTNG---TQIGNVTAVAPVPEKLAEVHID----Q 64
            ::|.:|....|.....|||.||:   :..| .|:|   |:..:.|.:.|..:....:.::    .
  Rat    10 VVLFLLGIGHCKGGQFKIKKTTQ---RRYPRATDGKEETKKCSYTFLVPEQKITGPICVNTKGQD 71

  Fly    65 HKTIR--ISKGDLDDLLDVYM----------------GKIAESAATIKDKENEINKLQTK--DQT 109
            ..||:  |::.||::|.||..                |.|......::.:...:|...|:  .|.
  Rat    72 AGTIKDMITRMDLENLKDVLSRQKREIDVLQLVVDVDGNIVNEVKLLRKESRNMNSRVTQLYMQL 136

  Fly   110 GDELLRKFENLTQVCSAQQS--SFTTAIKEKDEQIKELEQKVKVYETRLKRKQHVLAELRKLNGS 172
            ..|::||.:|..::...:..  :.||.:.:...:.:|||.|              .|.|..|..:
  Rat   137 LHEIIRKRDNSLELSQLENKILNVTTEMLKMATRYRELEVK--------------YASLTDLVNN 187

  Fly   173 SALLIEHLKGKVV-YFERK------------------FREKKDDLLADWEAATTSCVPFGRSPGI 218
            .:::|..|:.:.: .|.|:                  ..:....|||..|.......|....|..
  Rat   188 QSVMITVLEEQCLRLFSRQDPHVSPPLVQVVPRHIPNSHQDTPGLLAGNEIQRDPGYPRDLMPPP 252

  Fly   219 HLIHLPGFLPFLVPC-----EGQTAAGPGW 243
            .|...|...||.:|.     ||:......|
  Rat   253 DLATAPTKSPFKIPAVTFINEGELPFPGQW 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352 20/110 (18%)
FReD 213..413 CDD:238040 9/36 (25%)
Angptl1NP_001102853.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12326
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.