DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and LOC594984

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001025596.1 Gene:LOC594984 / 594984 -ID:- Length:318 Species:Xenopus tropicalis


Alignment Length:200 Identity:80/200 - (40%)
Similarity:118/200 - (59%) Gaps:6/200 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 GIHLIHLPGFLPFLVPCEGQTAAGPGWTCIQRRLDGSVNFYRNWDAYSKGFGKLNGEFFIGLEKL 281
            |.:.|:.|..||..|.|:.:|..| ||...|||.||||:|::.||:|.:|||:.:.||::|.|.|
 Frog   121 GWYTIYRPNGLPLPVFCDMETDGG-GWIVFQRRKDGSVDFFQEWDSYKRGFGRQDSEFWLGNENL 184

  Fly   282 HRLTSSQPHELYISIRRFGGETSYAHYDDFLIGSEEEGYELKLLGHYQGNASDALRTHDKMKFST 346
            |.||::...:|.:.:..|....::|.|.:|.||.|...|.|.|.|...|:|.|:|..|...:||:
 Frog   185 HLLTATGNFQLRVDLMDFDSNRTFASYSNFRIGGESRNYTLSLGGFTGGDAGDSLSGHKNREFSS 249

  Fly   347 YDRDNDAFTHMNCAEHHQGAWWYDFCSRSNLNGRYFKGEVDN-PQSIYWEP--WYSFRSLKSVQM 408
            .|||||: :..:|||.::|||||..|..|||||.|..|:..: ...:.|:.  .|:: |.|..:|
 Frog   250 KDRDNDS-SPTSCAERYKGAWWYSGCHTSNLNGLYLGGKHGSFANGVNWKSGGGYNY-SYKVSEM 312

  Fly   409 LIRPK 413
            ..||:
 Frog   313 KFRPQ 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352
FReD 213..413 CDD:238040 79/198 (40%)
LOC594984NP_001025596.1 Collagen 42..99 CDD:189968
FReD 107..316 CDD:238040 78/197 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm14088
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.