DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and LOC566119

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001315003.1 Gene:LOC566119 / 566119 -ID:- Length:245 Species:Danio rerio


Alignment Length:205 Identity:79/205 - (38%)
Similarity:114/205 - (55%) Gaps:13/205 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 IHLIHLPGFLPFLVPC----EGQTAAGPGWTCIQRRLDGSVNFYRNWDAYSKGFGKLNGEFFIGL 278
            ::.||..|..|....|    :|:.....|||.||||:||::|||:.|..|.:|||.:.||.::||
Zfish    41 VYTIHPDGDHPHHAFCHMVSDGRDEDNGGWTVIQRRMDGTLNFYQPWKEYKRGFGSMEGEHWMGL 105

  Fly   279 EKLHRLTSSQPHELYISIRRFGGETSYAHYDDFLIGSEEEGYELKLLGHYQGNASDALRTHDKMK 343
            |.:|.:|..:.|.|.:.:..|.|...:|||..|.:.||::||:|.:.|...|.|.|:|..|::||
Zfish   106 EHIHHMTRHKRHMLRVDMEDFEGRRGFAHYTSFSVASEDDGYKLHISGFRDGGAGDSLTAHNEMK 170

  Fly   344 FSTYDRDNDAFTHMNCAEHHQGAWWYDFCSRSNLNGRYFKGEVDNPQ---SIYWEPW---YSFRS 402
            |||:|:|.|.: ..|||....|.:||..|..:|.||.|..|. |...   .:.|..|   | :.|
Zfish   171 FSTFDKDQDLY-EKNCAREFLGGFWYKKCHHANPNGVYLWGH-DRTHYAIGVCWWSWDHNY-YNS 232

  Fly   403 LKSVQMLIRP 412
            ||.:.|.|:|
Zfish   233 LKHITMRIKP 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352
FReD 213..413 CDD:238040 79/205 (39%)
LOC566119NP_001315003.1 FReD 25..242 CDD:238040 78/203 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.