Sequence 1: | NP_610396.2 | Gene: | CG8642 / 35845 | FlyBaseID: | FBgn0033312 | Length: | 429 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009294451.1 | Gene: | LOC555374 / 555374 | -ID: | - | Length: | 242 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 83/207 - (40%) |
---|---|---|---|
Similarity: | 121/207 - (58%) | Gaps: | 11/207 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 217 GIHLIHLPGFLPFLVPC----EGQTAAGPGWTCIQRRLDGSVNFYRNWDAYSKGFGKLNGEFFIG 277
Fly 278 LEKLHRLTSSQPHELYISIRRFGGETSYAHYDDFLIGSEEEGYELKLLGHYQGNASDALRTHDKM 342
Fly 343 KFSTYDRDNDAFTHMNCAEHHQGAWWYDFCSRSNLNGRYFKGEVDNPQSIYWEPWYSFRS----- 402
Fly 403 LKSVQMLIRPKS 414 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8642 | NP_610396.2 | GluZincin | 72..>163 | CDD:301352 | |
FReD | 213..413 | CDD:238040 | 81/204 (40%) | ||
LOC555374 | XP_009294451.1 | FReD | 23..241 | CDD:238040 | 81/204 (40%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000029 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X25 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.000 |