DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and angptl3

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001011408.1 Gene:angptl3 / 496885 XenbaseID:XB-GENE-6258790 Length:456 Species:Xenopus tropicalis


Alignment Length:419 Identity:118/419 - (28%)
Similarity:185/419 - (44%) Gaps:100/419 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 HKTIRISKGDLDD------LLDVYMGKIAESAATIKDKENEINKLQTKDQTGDELLR-------- 115
            |||    ||.:::      :.|..:..::|....|::||.|:....:|.|..:|.|:        
 Frog    59 HKT----KGQINEIFQKLNIFDKSVTDLSEQTNEIREKEEELKDTTSKLQENNEELKNISRKINS 119

  Fly   116 KFENLTQ--------VCSAQQ------------------SSFTTAIKEKDEQIKELEQKVKVYET 154
            :.|||.|        |.|.::                  ||....::::|..|:.|   :||.:.
 Frog   120 QVENLLQDKIHLQAKVGSLEEKLFQMTQGTTEGQEIKEISSLKNFVEQQDVNIRHL---LKVVQE 181

  Fly   155 RLKRKQHVLAELRKLNG--SSALLIEHLKGKVVYFERKFR--------------EKKD-----DL 198
            :..:..|...:::.|..  |.|.|.|.:|.  |...|:.|              |:.|     |:
 Frog   182 QHMQLDHQNVQIKDLEDKLSKADLQESVKS--VLAVRRSRTGFLNLSNSTDGMVEQNDSRDCNDI 244

  Fly   199 LADWEAATTSCVPFGRSPGIHLIHLPGFLPFLVPCEGQTAAGPGWTCIQRRLDGSVNFYRNWDAY 263
            ....|          ||.||:.|...|...|.|.||..:.:..  |.||||.||||:|.:.|:.|
 Frog   245 YNRGE----------RSSGIYTIRPNGSTAFDVYCEITSESAN--TVIQRRTDGSVDFNQTWETY 297

  Fly   264 SKGFGKLNGEFFIGLEKLHRLTSSQPHELYISIRRFGGETSYAHYDDFLIGSEEEGYELKLLGHY 328
            ..|||:|.|||::||||:|.::....:.|:|.::.:.....:..| .|.:|:::..|.|:|. ..
 Frog   298 LNGFGELTGEFWLGLEKIHAISQQADYILHIELQDWKENWRFVEY-MFTLGNQDTSYALQLT-QV 360

  Fly   329 QGNASDALRTHDKMKFSTYDRDNDAFTHMNC-AEHHQGAWWYDFCSRSNLNGRYFK----GEVD- 387
            .||...||....::.|||.|:::.   .:.| ||...|.||...||.:||||:|.|    .::| 
 Frog   361 SGNIPSALPEQREILFSTSDQNSG---DLKCPAETFSGGWWNTACSGTNLNGKYIKQRPRTKLDR 422

  Fly   388 -NPQSIYWEP----WYSFRSLKSVQMLIR 411
             ..|.|||:.    .||.:|.|.  ||.|
 Frog   423 RRGQGIYWKSEKGRLYSLKSTKI--MLYR 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352 26/130 (20%)
FReD 213..413 CDD:238040 76/210 (36%)
angptl3NP_001011408.1 SMC_N <58..>206 CDD:330553 32/153 (21%)
FReD 239..447 CDD:238040 75/226 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I3977
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.