DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and Angptl4

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_954546.1 Gene:Angptl4 / 362850 RGDID:735058 Length:405 Species:Rattus norvegicus


Alignment Length:310 Identity:100/310 - (32%)
Similarity:155/310 - (50%) Gaps:41/310 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 SFTTAIKEKDEQIKELEQKVKVYETRLKRKQHVLAELRKLNGSSALLI-EHLKGKVVYFERKFRE 193
            |..|.:|.::.:|::|.||| ..:.|...||::  .::.|.....||. .||...|   ::..|.
  Rat   103 SLQTQLKAQNSKIQQLFQKV-AQQQRYLSKQNL--RIQNLQSQIDLLTPTHLDNGV---DKTSRG 161

  Fly   194 KKDDLLADWEAATTSCVPFGRSP--------------GIHLIHLPGFLPFLVPCEGQTAAGPGWT 244
            |:...:|.....|.:.....|.|              |:..|...|..||||.|| .|:.| |||
  Rat   162 KRLPKMAQLIGLTPNATRLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCE-MTSDG-GWT 224

  Fly   245 CIQRRLDGSVNFYRNWDAYSKGFGKLNGEFFIGLEKLHRLTSSQPHELYISIRRFGGETSYAHYD 309
            .|||||:|||:|.::|:||..|||...|||::||||:|.:|..:..:|.:.::.:.|......:.
  Rat   225 VIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGDRGSQLAVQLQDWDGNAKLLQFP 289

  Fly   310 DFLIGSEEEGYELKL-------LGHYQGNASDALRTHDKMKFSTYDRDNDAFTHMNCAEHHQGAW 367
            ..| |.|:..|.|:|       ||     |::.......:.|||:|:|:|....:|||:...|.|
  Rat   290 IHL-GGEDTAYSLQLTEPTANELG-----ATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGW 348

  Fly   368 WYDFCSRSNLNGRYF----KGEVDNPQSIYWEPWYS-FRSLKSVQMLIRP 412
            |:..||.|||||:||    :......:.|:|:.|.. :..|::..:||:|
  Rat   349 WFGTCSHSNLNGQYFHSIPRQRQQRKKGIFWKTWKGRYYPLQATTLLIQP 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352 11/32 (34%)
FReD 213..413 CDD:238040 79/226 (35%)
Angptl4NP_954546.1 FReD 182..399 CDD:238040 79/225 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.