DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and wu:fj11g02

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001373547.1 Gene:wu:fj11g02 / 335430 ZFINID:ZDB-GENE-030131-7370 Length:246 Species:Danio rerio


Alignment Length:204 Identity:82/204 - (40%)
Similarity:118/204 - (57%) Gaps:11/204 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 GIHLIHLPGFLPFLVPC----EGQTAAGPGWTCIQRRLDGSVNFYRNWDAYSKGFGKLNGEFFIG 277
            |::.||..|..|..|.|    :|:.....|||..|||:||||||||.|..|.:|||.:.||:::|
Zfish    42 GVYTIHPAGETPVWVYCQMVSDGKDEENGGWTVFQRRMDGSVNFYRPWRDYKRGFGNVEGEYWLG 106

  Fly   278 LEKLHRLTSSQPHELYISIRRFGGETSYAHYDDFLIGSEEEGYELKLLGHYQGNASDALRTHDKM 342
            ||.|::||..:...|.:.:..|.|...:|.|..|.:|.|.:||:|::.|...|.|.|::..|:.|
Zfish   107 LENLYQLTRHKKFMLRVDLEDFTGRKGFAQYSSFSVGCETDGYKLQVSGFKDGGAGDSMTYHNGM 171

  Fly   343 KFSTYDRDNDAFTHMNCAEHHQGAWWYDFCSRSNLNGRYFKGEVDNPQSIYWEPWYSFRS----- 402
            ||||:|:|.|.| ..:||..:.||:||:.|..:||||.|..|| |.........||.::|     
Zfish   172 KFSTFDKDQDNF-DKSCARLYLGAFWYNNCHHANLNGVYLWGE-DATIFAIGNVWYGWKSNYGIG 234

  Fly   403 LKSVQMLIR 411
            :||:.|.|:
Zfish   235 MKSITMKIK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352
FReD 213..413 CDD:238040 82/204 (40%)
wu:fj11g02NP_001373547.1 FReD 25..243 CDD:238040 81/202 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm6504
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.