DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and CG1889

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_727376.2 Gene:CG1889 / 31928 FlyBaseID:FBgn0030164 Length:338 Species:Drosophila melanogaster


Alignment Length:301 Identity:108/301 - (35%)
Similarity:154/301 - (51%) Gaps:23/301 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 SSFTTAIKEKDEQIKELEQKVKVYETRLKRKQHVLAELRKLNGSS---ALLIEHLKGKVVYFERK 190
            |..||.::..:.:|..:::::       ...|..|.:||:. ||:   .|...:.......|...
  Fly    48 SGLTTRMQSLNNEIASVKEQI-------GSLQEQLVDLRRA-GSAPVVGLASPNALASRFPFSHN 104

  Fly   191 FREKKDDLLADWEAATTSCVP---FGRSPGIHLIH-LPGFLPFLVPCEGQTAAGPGWTCIQRRLD 251
            ..:.:..|||:..||.....|   ..:..|:..|. .....||.|.|:.:...| |||.:..|.|
  Fly   105 SLDIEPQLLANGGAAAVPITPANCLKQQHGVVRIRPRSNVEPFFVFCDQKVRNG-GWTMVVNRYD 168

  Fly   252 GSVNFYRNWDAYSKGFGKLNGEFFIGLEKLHRLTSSQPHELYISIRRFGGETSYAHYDDFLIGSE 316
            ||.:|.|.|..|..|||.|..||||||:|||::|||..:||.:.::....|..||.||.|.||||
  Fly   169 GSEDFNRKWADYKIGFGPLTTEFFIGLDKLHQITSSDNYELLVQLQNRKQELRYALYDHFSIGSE 233

  Fly   317 EEGYELKLLGHYQGNASDALRTHDKMKFSTYDRDNDAFTHMNCAEHHQGAWWY-DFCSRSNLNGR 380
            .|.|.|.:||.|.|:|:||||.|...||||:||.||. ...|||....||:|| ..|:.:|..|.
  Fly   234 SEQYRLNVLGDYHGDAADALRDHTGKKFSTHDRVNDE-NEQNCAAQQSGAFWYGGSCNLTNPFGL 297

  Fly   381 Y---FKGEVDNPQSIYWEPWYS--FRSLKSVQMLIRPKSQL 416
            |   .:.:||..:.|.|..:.:  ..|||.|:|::||::.|
  Fly   298 YQRLLERDVDGFKGILWRGFLNGPKGSLKIVRMMVRPRAAL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352 5/33 (15%)
FReD 213..413 CDD:238040 88/206 (43%)
CG1889NP_727376.2 Lzipper-MIP1 <34..80 CDD:291087 7/38 (18%)
FReD 123..335 CDD:238040 89/213 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D94621at50557
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
87.970

Return to query results.
Submit another query.