DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and CG31832

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:212 Identity:104/212 - (49%)
Similarity:134/212 - (63%) Gaps:6/212 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 EAATTSCVPFGRSPGIHLIHLPGFLPFLVPCEGQTAAGPGWTCIQRRLDGSVNFYRNWDAYSKGF 267
            :::..:| |.|...|||.:.||...||.|.....||.  .|..|||||||||||.::|.:|..||
  Fly    19 QSSPHTC-PSGSPNGIHQLMLPEEEPFQVTQCKTTAR--DWIVIQRRLDGSVNFNQSWFSYKDGF 80

  Fly   268 GKLNGEFFIGLEKLHRLTSSQPHELYISIRRFGGETSYAHYDDFLIGSEEEGYELKLLGHYQGNA 332
            |..||||||||:||:.:|..|||||:|.::...|.|.|||:|||.:.||.|.|:|:.:|.|.|.|
  Fly    81 GDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTA 145

  Fly   333 SDALRTHDKMKFSTYDRDNDAFTHMNCAEHHQGAWWYDFCSRSNLNGRYFK-GEVDNPQSIYWEP 396
            .|:||.|...:|||:|||||. :..|||..|.|.||:..|..|:|||.||: ||......|:|..
  Fly   146 GDSLRYHINKRFSTFDRDNDE-SSKNCAAEHGGGWWFHSCLSSSLNGLYFREGETGMLNGIHWGR 209

  Fly   397 WYSFRSLKSVQMLIRPK 413
            | .|:||..||::||||
  Fly   210 W-KFQSLTFVQIMIRPK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352
FReD 213..413 CDD:238040 100/200 (50%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 100/200 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D84222at33392
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
87.970

Return to query results.
Submit another query.