DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and Fibcd1

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001101299.1 Gene:Fibcd1 / 311861 RGDID:1309097 Length:459 Species:Rattus norvegicus


Alignment Length:369 Identity:116/369 - (31%)
Similarity:175/369 - (47%) Gaps:80/369 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 DLLDVYMGKIAESAATIKDKENEINKLQTKDQTGDELL--------RKFENLTQVCSAQQSSFTT 133
            :|||....::....|...:.:.|...|    :.|..||        .:...|.|:.|..|.....
  Rat   133 ELLDALADQLPRLLARASELQAECAGL----RKGHSLLGQGLSTLQSEQGRLIQLLSESQGHMAH 193

  Fly   134 AIKEKDEQIKELEQKVKVYETRLKRKQHVLAELRK-----------LNGSSALLIEHLKGKVVYF 187
            .:....:.::.|:::..:...|:|      |:|::           .|||               
  Rat   194 LVNSVSDVLEALQRERGLGRPRVK------ADLQRAPSRGARPRGCANGS--------------- 237

  Fly   188 ERKFREKKDDLLADWEAATTSCVPFGRSPGIHLI---HLPGFLPFLVPCEGQTAAGPGWTCIQRR 249
              :.|:..|.||:..:           ..|::.:   |.|.  .|.|.|:.:|..| |||..|||
  Rat   238 --RPRDCLDVLLSGQQ-----------DDGVYSVFPTHYPA--GFQVYCDMRTDGG-GWTVFQRR 286

  Fly   250 LDGSVNFYRNWDAYSKGFGKLNGEFFIGLEKLHRLTSSQPHELYISIRRFGGETSYAHYDDFLIG 314
            .||||||:|.|:||.:|||||.||.::||:::|.||:...:||::.:..|...|:||||..|.:|
  Rat   287 EDGSVNFFRGWEAYREGFGKLTGEHWLGLKRIHALTTQAAYELHVDLEDFDNGTAYAHYGSFGVG 351

  Fly   315 -----SEEEGYELKLLGHYQGNASDALRTHDKMKFSTYDRDNDAFTHMNCAEHHQGAWWYDFCSR 374
                 .||:||.| .:..|.|.|.|:|..|..|:|:|.|||:| .:..|||..::|||||..|..
  Rat   352 LFSVDPEEDGYPL-TVADYSGTAGDSLLKHSGMRFTTKDRDSD-HSENNCAAFYRGAWWYRNCHT 414

  Fly   375 SNLNGRYFKGEVDNPQSIY-----WEPWYSFR-SLKSVQMLIRP 412
            |||||:|.:|    |.:.|     |..|..:: |||..:|.|||
  Rat   415 SNLNGQYLRG----PHASYADGVEWSSWTGWQYSLKFSEMKIRP 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352 16/93 (17%)
FReD 213..413 CDD:238040 91/214 (43%)
Fibcd1NP_001101299.1 FReD 239..455 CDD:238040 95/236 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H122246
Inparanoid 1 1.050 188 1.000 Inparanoid score I3814
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm12326
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.