DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and Angpt4

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001099996.1 Gene:Angpt4 / 296269 RGDID:1307539 Length:508 Species:Rattus norvegicus


Alignment Length:431 Identity:115/431 - (26%)
Similarity:184/431 - (42%) Gaps:68/431 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 WCLQVPSKIKSTTKAPVKEIPPTNGTQIGNVTAVAPVPEKLAEVHIDQHKTIRISKGDLDDLLDV 81
            |.|::...|:...::.:.: ...:..|....|.:|.....:.:.....||...:....|:....|
  Rat   108 WLLKLEQSIQMNLRSDLAQ-AQQHTIQNQTTTMLALGANLMNQTMAQTHKLTAVEAQVLNHTSRV 171

  Fly    82 YMGKIAESAATIK------DKENEINKLQTKDQTGDELLRKFENLTQVCSAQQSSFTTAIKEKDE 140
            ....:..|.:|.|      .:..|:.:||.::       |..|...|...||..:...::::|.|
  Rat   172 KTQMLESSLSTNKLERQMLMQSRELQRLQGRN-------RALETRLQALEAQHQAQLNSLQDKRE 229

  Fly   141 QIKELEQKVKVYETRLKRKQHVLA----ELRKLNGSSALLIEHLKGKVVYFERKFREKKDD---- 197
            |::.|          |..:...||    .||.|:.:|:.|.:..:..:...:|..|....|    
  Rat   230 QLQSL----------LGHQTGALANLKHSLRALSSNSSSLQQQQQQLMELVQRLVRIVAQDQHPV 284

  Fly   198 -------LLADWEAATTSCVPFGRS----PGIHLIHLPGFL-PFLVPCEGQTAAGPGWTCIQRRL 250
                   |..|       |....||    .|::.||..... |..|.|:.:|..| |||.||||.
  Rat   285 SLKTPKPLFRD-------CAEIKRSGANTSGVYTIHGANMTKPLKVFCDMETDGG-GWTLIQRRE 341

  Fly   251 DGSVNFYRNWDAYSKGFGKLNGEFFIGLEKLHRLTSSQPHELYISIRRFGGETSYAHYDDFLIGS 315
            |||:||.|.|:.|.:|||.:..|.::|.|.:|.|||...:.|.:.:..:.|..:...|::|.:||
  Rat   342 DGSLNFQRTWEEYKEGFGNVAREHWLGNEAVHSLTSRTAYLLRVELHDWEGHQTSIQYENFQLGS 406

  Fly   316 EEEGYELKLLGHYQGNASDALRTHDKM-----KFSTYDRDNDAFTHMNCAEHHQGAWWYDFCSRS 375
            |.:.|.|.:     .::|.:.|..:.:     ||||.|.|||. ....||:...|.||:|.|..|
  Rat   407 ERQRYSLSV-----NDSSISARLKNSLAPQGTKFSTKDMDNDN-CMCKCAQMLSGGWWFDACGLS 465

  Fly   376 NLNGRYFKGEVDNPQSIYWEPWYSFR----SLKSVQMLIRP 412
            ||||.|:... .:...|....|:.||    ||...:|::||
  Rat   466 NLNGIYYPVH-QHLHKINGIRWHYFRGPSYSLHGTRMMLRP 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352 18/96 (19%)
FReD 213..413 CDD:238040 76/214 (36%)
Angpt4NP_001099996.1 FReD 291..506 CDD:238040 79/230 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.