DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and ANGPT2

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001138.1 Gene:ANGPT2 / 285 HGNCID:485 Length:496 Species:Homo sapiens


Alignment Length:433 Identity:126/433 - (29%)
Similarity:196/433 - (45%) Gaps:69/433 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 WCLQVPSKIKSTTKAPVKEIPPTNGTQIGNVTAV------------APVPEKLAEVHID-QHKTI 68
            |.:::.:.|:...|..:.|| ..|..|  |.|||            |....||.:|... .::|.
Human    93 WLMKLENYIQDNMKKEMVEI-QQNAVQ--NQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTT 154

  Fly    69 RISKGDLDDLLDVYMGKIAESAATIKDKENEINKLQTKDQTGDELLRKFEN----LTQVCSAQQS 129
            |:....|:..|..  .|:.:.   |.|:.:||||||.|:...::.:...|:    ..|....::.
Human   155 RLELQLLEHSLST--NKLEKQ---ILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKD 214

  Fly   130 SFTTAIKEKDEQIKELEQKV---KVYETRLKRKQHVLAE-----LRKLNGSSALLIEHLKGKVVY 186
            .....:.:::..|:|||:|:   .|..:.|:::||.|.|     |..::.|::            
Human   215 QLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNS------------ 267

  Fly   187 FERKFREKKDDLLADWEAAT-TSCVPFGRS----PGIHLIHLPGFLPFLVPCEGQTAAGPGWTCI 246
                   .||..:|..|..: ..|....:|    .||:.:..|.....:.......|.|.|||.|
Human   268 -------AKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTII 325

  Fly   247 QRRLDGSVNFYRNWDAYSKGFGKLNGEFFIGLEKLHRLTSSQPHELYISIRRFGGETSYAHYDDF 311
            |||.||||:|.|.|..|..|||..:||:::|.|.:.:||:.|.:.|.|.::.:.|..:|:.|:.|
Human   326 QRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHF 390

  Fly   312 LIGSEEEGYELKLLGHYQGNA----SDALRTHDKMKFSTYDRDNDAFTHMNCAEHHQGAWWYDFC 372
            .:.|||..|.:.|.| ..|.|    |.:...:|   |||.|.|||... ..|::...|.||:|.|
Human   391 YLSSEELNYRIHLKG-LTGTAGKISSISQPGND---FSTKDGDNDKCI-CKCSQMLTGGWWFDAC 450

  Fly   373 SRSNLNGRYF--KGEVDNPQSIYWEPWY-SFRSLKSVQMLIRP 412
            ..|||||.|:  :...:....|.|..|. |..|||:..|:|||
Human   451 GPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRP 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352 23/97 (24%)
FReD 213..413 CDD:238040 77/211 (36%)
ANGPT2NP_001138.1 SMC_N <78..>295 CDD:330553 50/228 (22%)
FBG 280..494 CDD:214548 78/219 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41874
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.