DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and Tnr

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_037177.2 Gene:Tnr / 25567 RGDID:3886 Length:1358 Species:Rattus norvegicus


Alignment Length:413 Identity:128/413 - (30%)
Similarity:187/413 - (45%) Gaps:58/413 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PSKIKSTTKAPVKEIPP-----TNGTQIGNVTAVAPVPE--KLAEVHIDQHKTIRI--SKGDLDD 77
            |::.....|||:.|:..     |:....|....|..|.|  :|.::....|.|:.:  :.|.|  
  Rat   966 PTEALLQWKAPMGEVENYVIVLTHFAMAGETILVDGVSEEFQLVDLLPRTHYTVTMYATSGPL-- 1028

  Fly    78 LLDVYMGKIAESAATIKDKENEINKLQTKDQTGDELLRKFENLT-QVCSAQQSSFTTAIKEKDEQ 141
                ..|.||.:.:|:.|....:        |..|:.|:...:: |...|...::....|..|..
  Rat  1029 ----VSGTIATNFSTLLDPPANL--------TASEVTRQSALISWQPPRAAIENYVLTYKSTDGS 1081

  Fly   142 IKELEQKVKVYETRLKRKQH-----VLAELRKLNGSSAL--LIEHLKGKVVYFERKFREKKDDLL 199
            .|||....:....||:....     ||.:..:....|:|  .|....|:|      |...:|...
  Rat  1082 RKELIVDAEDTWIRLEGLSENTDYTVLLQAAQEATRSSLTSTIFTTGGRV------FSHPQDCAQ 1140

  Fly   200 ADWEAATTSCVPFGRSPGIHLIHLPGFL--PFLVPCEGQTAAGPGWTCIQRRLDGSVNFYRNWDA 262
            ......|.|        |::.|.|.|.|  ...|.|: .|..|.||...|||.:|..:|:|.|..
  Rat  1141 HLMNGDTLS--------GVYTIFLNGELSHKLQVYCD-MTTDGGGWIVFQRRQNGQTDFFRKWAD 1196

  Fly   263 YSKGFGKLNGEFFIGLEKLHRLTSSQPHELYISIRRFGGETSYAHYDDFLIGSEEEGYELKLLGH 327
            |..|||.|..||::||:.:||:|:...:||.:.:|. |.|..:|:||.|.:......|:|: :|.
  Rat  1197 YRVGFGNLEDEFWLGLDNIHRITAQGRYELRVDMRD-GQEAVFAYYDKFAVEDSRSLYKLR-IGG 1259

  Fly   328 YQGNASDALRTHDKMKFSTYDRDND-AFTHMNCAEHHQGAWWYDFCSRSNLNGRYFKGEVDNPQS 391
            |.|.|.|:|..|....|||.||||| |.|  |||..::|||||..|.|:||||:|  ||..:.|.
  Rat  1260 YNGTAGDSLSYHQGRPFSTEDRDNDVAVT--NCAMSYKGAWWYKNCHRTNLNGKY--GESRHSQG 1320

  Fly   392 IYWEPW--YSFRSLKSVQMLIRP 412
            |.|..|  :.| |:..|:|.:||
  Rat  1321 INWYHWKGHEF-SIPFVEMKMRP 1342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352 19/96 (20%)
FReD 213..413 CDD:238040 85/205 (41%)
TnrNP_037177.2 exchanger_TraA <190..>328 CDD:411343
EGF_Tenascin 203..231 CDD:376143
fn3 328..398 CDD:394996
fn3 416..496 CDD:394996
fn3 507..586 CDD:394996
FN3 595..679 CDD:238020
fn3 687..766 CDD:394996
fn3 776..855 CDD:394996
fn3 865..944 CDD:394996
fn3 954..1026 CDD:394996 13/59 (22%)
FN3 1042..1127 CDD:238020 18/92 (20%)
FReD 1134..1342 CDD:238040 86/223 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12326
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - LDO PTHR19143
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.