DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and CG30281

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster


Alignment Length:251 Identity:112/251 - (44%)
Similarity:155/251 - (61%) Gaps:12/251 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 LIEHLKGKVVYFERKFREKKDDLLADWEAATTSCVPFG-RSPGIHLIHLPGFLPFLVPCEGQTAA 239
            ::..||.::...::.::|..::..:......:||:..| .|.|||:|.:||..||.|.|:.: .|
  Fly    35 MVSSLKIRLEELKQSYKEITEERGSHETINPSSCLAAGINSNGIHVIEVPGLEPFPVYCDTR-LA 98

  Fly   240 GPGWTCIQRRLDGSVNFYRNWDAYSKGFGKLNGEFFIGLEKLHRLTSSQPHELYISIRRFGGETS 304
            |.|||.||||.|||.||||.|:.||:|||:|:||||:||||||.||:::|:||::.:..|.|...
  Fly    99 GSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVH 163

  Fly   305 YAHYDDFLIGSEEEGYELKLLGHYQGNASDALRTHDKMKFSTYDRDNDAFTHMNCAEHHQGAWWY 369
            .|.|:||.||:....|.|.:||.|.|:|.|:||.|..|.|||:|.|:   |...||..:.|||||
  Fly   164 DARYEDFAIGNASASYALSVLGKYSGDAGDSLRYHKGMPFSTFDHDD---TGHGCARIYVGAWWY 225

  Fly   370 DFCSRSNLNGRYFKGEVDNP----QSIYWEPW--YSFRSLKSVQMLIRPKSQLELK 419
            |.|.||||||:|.:|....|    :.|.|..|  |.: ..|.|||:||||....|:
  Fly   226 DQCQRSNLNGQYLEGGRFEPKMSGRGITWMSWRGYDY-GYKFVQMMIRPKCSNNLR 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352
FReD 213..413 CDD:238040 104/206 (50%)
CG30281NP_726164.1 FReD 63..274 CDD:238040 106/215 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3330
eggNOG 1 0.900 - - E1_KOG2579
Homologene 1 1.000 - - H122246
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D49112at7147
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm6504
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
1110.870

Return to query results.
Submit another query.