DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and FGL1

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_004458.3 Gene:FGL1 / 2267 HGNCID:3695 Length:312 Species:Homo sapiens


Alignment Length:308 Identity:107/308 - (34%)
Similarity:158/308 - (51%) Gaps:52/308 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 TAIKEKDEQIKELEQKVKVYETRLKRKQHVLAELRKLNGSSALLIEHLKGKVVYFERKFREKKD- 196
            :|:::..::...|..:|::.|||:|::|..:.:|.:.|                 |.:|.:|.| 
Human    21 SALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQEN-----------------EVQFLDKGDE 68

  Fly   197 ----DLLADWEAATTSCVPFG---RSPGIHLIH-LPGFLPFLVPCEGQTAAGPGWTCIQRRLDGS 253
                ||.:..:.|..|.: |.   :..|.:.|. |.....|.|.|:  .:.|.|||.||||.|||
Human    69 NTVIDLGSKRQYADCSEI-FNDGYKLSGFYKIKPLQSPAEFSVYCD--MSDGGGWTVIQRRSDGS 130

  Fly   254 VNFYRNWDAYSKGFGKL---NGEFFIGLEKLHRLTSSQPHELYISIRRFGGETSYAHYDDFLIGS 315
            .||.|.|..|..|||..   :||:::|.:.||.||:.:.:.|.|.:..|...:.||.|.:|.:|.
Human   131 ENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGD 195

  Fly   316 EEEGYELKLLGHYQGNASDAL-----------RTHDKMKFSTYDRDNDAFTHMNCAEHHQGAWWY 369
            |:..|||. :|.|.|.|.|:|           .:|.:|||||:|||:|.: ..||||..|..||:
Human   196 EKNFYELN-IGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNY-EGNCAEEDQSGWWF 258

  Fly   370 DFCSRSNLNGRYFKG----EVDNPQSIYWEPWYS-FRSLKSVQMLIRP 412
            :.|..:||||.|:.|    :.||  .|.|..|:. :.|||||.|.|||
Human   259 NRCHSANLNGVYYSGPYTAKTDN--GIVWYTWHGWWYSLKSVVMKIRP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352 8/29 (28%)
FReD 213..413 CDD:238040 88/223 (39%)
FGL1NP_004458.3 FReD 78..304 CDD:238040 89/232 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40314
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.