DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and FGG

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_068656.2 Gene:FGG / 2266 HGNCID:3694 Length:453 Species:Homo sapiens


Alignment Length:388 Identity:116/388 - (29%)
Similarity:177/388 - (45%) Gaps:50/388 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LLDVYMGKIAESAATIKDKENEINKLQTKD-QTGDELLRKFENLT----QVCSAQQSSFTTAIKE 137
            :||...|....:...|.|..:.......|| |:.:::|.:.||.|    |:..|.|.::......
Human    36 ILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESS 100

  Fly   138 KDEQI--------KELEQKVKVYETRLKRKQHVLAELRKLNGSSALLIEHLKGKVVYFERKFREK 194
            |...|        |.||:.:| ||..:......:..|:::..|:...|.:||.||...|.:.:|.
Human   101 KPNMIDAATLKSRKMLEEIMK-YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEP 164

  Fly   195 KDDLLADWEAATTSCVPF----GRSPGIHLIH-LPGFLPFLVPCEGQTAAGPGWTCIQRRLDGSV 254
            ..|.:...:.....|...    .:..|::.|. |.....|||.|| ...:|.|||..|:||||||
Human   165 CKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCE-IDGSGNGWTVFQKRLDGSV 228

  Fly   255 NFYRNWDAYSKGFGKLN----GEFFIGLEKLHRLT--SSQPHELYISIRRFGGETSYAHYDDFLI 313
            :|.:||..|.:|||.|:    .||::|.||:|.::  |:.|:.|.:.:..:.|.||.|.|..|.:
Human   229 DFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKV 293

  Fly   314 GSEEEGYELKLLGHYQGNASDA--------------LRTHDKMKFSTYDRDNDAFTHMNCAEHHQ 364
            |.|.:.|.|.......|:|.||              ..:|:.|:|||:|.|||.| ..||||...
Human   294 GPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKF-EGNCAEQDG 357

  Fly   365 GAWWYDFCSRSNLNGRYFKG----EVDNP----QSIYWEPWYS-FRSLKSVQMLIRPKSQLEL 418
            ..||.:.|...:|||.|::|    :...|    ..|.|..|.: :.|:|...|.|.|.::|.:
Human   358 SGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352 23/97 (24%)
FReD 213..413 CDD:238040 80/229 (35%)
FGGNP_068656.2 Fib_alpha 31..172 CDD:285864 33/136 (24%)
FReD 175..414 CDD:294064 81/240 (34%)
Gamma-chain polymerization, binding amino end of another fibrin alpha chain 400..422 6/21 (29%)
Platelet aggregation and Staphylococcus clumping 423..437
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 424..453
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46437
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.