DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and FGB

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_005132.2 Gene:FGB / 2244 HGNCID:3662 Length:491 Species:Homo sapiens


Alignment Length:465 Identity:123/465 - (26%)
Similarity:191/465 - (41%) Gaps:127/465 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PSKIKSTTKAPVKEIPPTNG-----TQIGNVTAVAPVPEKLAEVHIDQHKTIRISKGDLDDLLDV 81
            |:|..:|.|...::.|...|     ..:|   .:.|...:|.|..:.|.:.||.|..:|::    
Human    75 PAKAAATQKKVERKAPDAGGCLHADPDLG---VLCPTGCQLQEALLQQERPIRNSVDELNN---- 132

  Fly    82 YMGKIAESAATIKDKENEINKLQTKDQTGDELLRKFENLTQVCSAQQSSFTTAIKEKD------E 140
                                                 |:..|.....|||......||      :
Human   133 -------------------------------------NVEAVSQTSSSSFQYMYLLKDLWQKRQK 160

  Fly   141 QIKELEQKVKVYETRLKRKQHVLAELRKLNGSSAL-----LIEHLKGKVVYFERKFREKKDDLLA 200
            |:|:.|..|..|.:.|::.|..:.|....|..:.|     ::|:|:.|:       ::.:.|:.|
Human   161 QVKDNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVLRSILENLRSKI-------QKLESDVSA 218

  Fly   201 DWEAATTSC-----VPF-------------GRSPGIHLIHLPGFL-PFLVPCEGQTAAGPGWTCI 246
            ..|...|.|     :|.             |.:..::||.....: |:.|.|:..|..| |||.|
Human   219 QMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENG-GWTVI 282

  Fly   247 QRRLDGSVNFYRNWDAYSKGFGK------------LNGEFFIGLEKLHRLTSSQPHELYISIRRF 299
            |.|.||||:|.|.||.|.:|||.            |.||:::|.:|:.:||...|.||.|.:..:
Human   283 QNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDW 347

  Fly   300 GGETSYAHYDDFLIGSEEEGYELKLLGHYQGNASDAL-----------RT---HDKMKFSTYDRD 350
            .|:...|||..|.:.:|...|::. :..|:|.|.:||           ||   |:.|.|||||||
Human   348 KGDKVKAHYGGFTVQNEANKYQIS-VNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRD 411

  Fly   351 NDAF----THMNCAEHHQGAWWYDFCSRSNLNGRYFKG--------EVDNPQSIYWEPWY-SFRS 402
            ||.:    ....|::...|.|||:.|..:|.||||:.|        :......:.|..|. |:.|
Human   412 NDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYS 476

  Fly   403 LKSVQMLIRP 412
            ::.:.|.|||
Human   477 MRKMSMKIRP 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352 15/96 (16%)
FReD 213..413 CDD:238040 82/240 (34%)
FGBNP_005132.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..75 123/465 (26%)
Beta-chain polymerization, binding distal domain of another fibrin 45..47
Fib_alpha 92..234 CDD:312286 35/192 (18%)
FReD 237..486 CDD:294064 80/250 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.