DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and FCN2

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_004099.2 Gene:FCN2 / 2220 HGNCID:3624 Length:313 Species:Homo sapiens


Alignment Length:198 Identity:84/198 - (42%)
Similarity:110/198 - (55%) Gaps:4/198 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 GIHLIHLPGFLPFLVPCEGQTAAGPGWTCIQRRLDGSVNFYRNWDAYSKGFGKLNGEFFIGLEKL 281
            |.|.|:||...|..|.|:..|..| |||..|||:||||:|||:|..|.:|||...|||::|.:.:
Human   117 GWHTIYLPDCRPLTVLCDMDTDGG-GWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNI 180

  Fly   282 HRLTSSQPHELYISIRRFGGETSYAHYDDFLIGSEEEGYELKLLGHYQGNASDALRTHDKMKFST 346
            |.||:....||.:.:..|.....:|.|..|.:..|.|.|.|.|....:|:|.|:|..|:...|||
Human   181 HALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFST 245

  Fly   347 YDRDNDAFTHMNCAEHHQGAWWYDFCSRSNLNGRYFKGEVDN-PQSIYWEPWYSFR-SLKSVQML 409
            .|:|||..|. |||...||||||..|..|||||||.:|...: ...|.|:....:. |.|..:|.
Human   246 KDQDNDLNTG-NCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMK 309

  Fly   410 IRP 412
            :||
Human   310 VRP 312

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352
FReD 213..413 CDD:238040 84/198 (42%)
FCN2NP_004099.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..99
FReD 102..312 CDD:238040 82/196 (42%)