DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and Y43C5A.2

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_501883.1 Gene:Y43C5A.2 / 177911 WormBaseID:WBGene00012782 Length:452 Species:Caenorhabditis elegans


Alignment Length:232 Identity:61/232 - (26%)
Similarity:91/232 - (39%) Gaps:50/232 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 TTSCVPFG----------------------RSPGIHLIHLPGFLPFLVPCEGQTAAGPGWTCIQR 248
            ||:.|||.                      .|.|:..|: |...|..|.|:  |.:...:|.||.
 Worm   175 TTTEVPFTGSTLPPTTTPKPPMDCSEISNLTSSGVQTIY-PNGSPVQVYCD--TTSYGTYTVIQS 236

  Fly   249 R--LDGSVNFYRNWDAYSKGFGKLNGE--FFIGLEKLHRLTSSQPHELYISIRRFGGETSYAH-- 307
            |  ...:|||...:|.|:...|....|  |:.||:.::.|:.::|:.|.|.:  ..|....|.  
 Worm   237 RGATGENVNFNITYDKYTDIIGTPGKETNFWFGLDNMNHLSGAKPYRLQIDL--CCGTLLVAKQI 299

  Fly   308 YDDFLIGSEEEGYELKLLGHYQGNASDALRTHDKM--KFSTYDR--------DNDAFTHMN---C 359
            |..|.:|:.|.||.|.......|.......|:..:  ||||:|.        |.|.|.:.:   .
 Worm   300 YHSFKVGTAEYGYNLTATADISGIGLAYSSTYTDLGAKFSTFDNFTGPLGKDDCDEFQYFDDSGV 364

  Fly   360 AEHHQGAWWYDFCSRSNLNGRYF---KGEVDNPQSIY 393
            .....|.|||..|. :||||.::   .|....|..::
 Worm   365 QSQPYGGWWYGSCG-NNLNGFWYPKRNGNCTVPDEVF 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352
FReD 213..413 CDD:238040 56/225 (25%)
Y43C5A.2NP_501883.1 FReD 196..438 CDD:238040 56/211 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.