DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and Fcnb

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_006497739.1 Gene:Fcnb / 14134 MGIID:1341158 Length:322 Species:Mus musculus


Alignment Length:157 Identity:56/157 - (35%)
Similarity:82/157 - (52%) Gaps:18/157 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 ERKFREKKDDLLADWEAATTSCVPFGRS-----------PGIHLIHLPGFLPFLVPCEGQTAAGP 241
            |:..|.:|.|     ...:.||....|:           .|.:.|:||...|..|.|:..|..| 
Mouse    83 EKGIRGEKGD-----SGPSQSCATGPRTCKELLTQGHFLTGWYTIYLPDCRPLTVLCDMDTDGG- 141

  Fly   242 GWTCIQRRLDGSVNFYRNWDAYSKGFGKLNGEFFIGLEKLHRLTSSQPHELYISIRRFGGETSYA 306
            |||..||||||||:|:|:|.:|.:|||...|||::|.:.:|.||:....||.:.:..|.|:..:|
Mouse   142 GWTVFQRRLDGSVDFFRDWTSYKRGFGSQLGEFWLGNDNIHALTTQGTSELRVDLSDFEGKHDFA 206

  Fly   307 HYDDFLIGSEEEGYELKLLGHYQGNAS 333
            .|..|.|..|.|.|:| :||::.|..:
Mouse   207 KYSSFQIQGEAEKYKL-ILGNFLGGGA 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352
FReD 213..413 CDD:238040 50/132 (38%)
FcnbXP_006497739.1 Collagen 40..95 CDD:189968 4/16 (25%)
FReD 103..>238 CDD:238040 50/132 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3330
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm42379
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.710

Return to query results.
Submit another query.