DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and Fcnb

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_446086.1 Gene:Fcnb / 114091 RGDID:621222 Length:319 Species:Rattus norvegicus


Alignment Length:238 Identity:87/238 - (36%)
Similarity:126/238 - (52%) Gaps:22/238 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 ERKFREKKDDLLADWEAATTSCVPFGRS-----------PGIHLIHLPGFLPFLVPCEGQTAAGP 241
            |:..|.:|.|     ...:.||....|:           .|.:.|:||...|..|.|:..|..| 
  Rat    88 EKGVRGEKGD-----TGPSQSCATGPRTCKELLTRGYFLTGWYTIYLPDCRPLTVLCDMDTDGG- 146

  Fly   242 GWTCIQRRLDGSVNFYRNWDAYSKGFGKLNGEFFIGLEKLHRLTSSQPHELYISIRRFGGETSYA 306
            |||..|||:||:|:|:|:|.:|.:|||...|||::|.:.:|.||:...:||.:.:..|.|...:|
  Rat   147 GWTVFQRRIDGTVDFFRDWTSYKQGFGSQLGEFWLGNDNIHALTTQGTNELRVDLADFDGNHDFA 211

  Fly   307 HYDDFLIGSEEEGYELKLLGHY-QGNASDALRTHDKMKFSTYDRDNDAFTHMNCAEHHQGAWWYD 370
            .|..|.|..|.|.|:| :||:: .|.|.|:|.:.:.|.|||.|:|||..: .|||..:.|||||.
  Rat   212 KYSSFQIQGEAEKYKL-ILGNFLGGGAGDSLTSQNNMLFSTKDQDNDQGS-SNCAVRYHGAWWYS 274

  Fly   371 FCSRSNLNGRYFKG-EVDNPQSIYWEPWYSFR-SLKSVQMLIR 411
            .|..|||||.|.:| .......:.|:.|..:. |.|..:|.:|
  Rat   275 DCHTSNLNGLYLRGLHKSYANGVNWKSWKGYNYSYKVSEMKVR 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352
FReD 213..413 CDD:238040 81/213 (38%)
FcnbNP_446086.1 Collagen 45..100 CDD:189968 4/16 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..106 6/22 (27%)
FReD 108..317 CDD:238040 80/211 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm12326
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.710

Return to query results.
Submit another query.