DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and LOC108179162

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_017211437.2 Gene:LOC108179162 / 108179162 -ID:- Length:243 Species:Danio rerio


Alignment Length:235 Identity:91/235 - (38%)
Similarity:131/235 - (55%) Gaps:19/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 LLADWEAATTS------CVPFGRS----PGIHLIHLPGFLPFLVPC----EGQTAAGPGWTCIQR 248
            ||:.:.|:..|      |....||    .||:.|:..|.:|..|.|    :|:.....|||..||
Zfish    10 LLSVFTASVVSGFKPFDCSEIYRSGQTVSGIYSIYPAGDIPVWVYCQMISDGKDEENGGWTVFQR 74

  Fly   249 RLDGSVNFYRNWDAYSKGFGKLNGEFFIGLEKLHRLTSSQPHELYISIRRFGGETSYAHYDDFLI 313
            |:||.:|||:.|:.|.:|||...||:::|||.|::||..:...|.:.:..|.|...:|.|..|.:
Zfish    75 RMDGRINFYQPWEEYKRGFGTTEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRRGFAQYSSFSV 139

  Fly   314 GSEEEGYELKLLGHYQGNASDALRTHDKMKFSTYDRDNDAFTHMNCAEHHQGAWWYDFCSRSNLN 378
            |||.|||.|::.|...|.|.|:|..|:..||||:|:|.||:.. |||:...||:|:.:|..:|.|
Zfish   140 GSEAEGYRLQVSGFTDGGAGDSLTDHNDQKFSTFDKDQDAYGD-NCAQEFLGAFWFKYCHNTNPN 203

  Fly   379 GRYFKGEVDNPQSI--YWEPWY-SFR-SLKSVQMLIRPKS 414
            |.|..||.|....|  .|..|. ||. |:||:.::|:.||
Zfish   204 GVYLWGEDDTHFGIGVVWSTWKDSFTVSMKSLSLMIKSKS 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352
FReD 213..413 CDD:238040 84/211 (40%)
LOC108179162XP_017211437.2 FReD 24..242 CDD:238040 85/218 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.