DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and LOC105947509

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_031760299.1 Gene:LOC105947509 / 105947509 -ID:- Length:304 Species:Xenopus tropicalis


Alignment Length:200 Identity:86/200 - (43%)
Similarity:112/200 - (56%) Gaps:12/200 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 GIHLIHLPGFLPFLVPCEGQTAAGPGWTCIQRRLDGSVNFYRNWDAYSKGFGKLNGEFFIGLEKL 281
            |.::|...|..|..|.|:..|..| ||...|||.||:|:|..:|:.|.:|||....||::|.:.|
 Frog   109 GWNIITPVGMSPLRVLCDMHTDGG-GWLVFQRRWDGTVSFNVDWNTYKRGFGSEMNEFWLGNDIL 172

  Fly   282 HRLTSSQPHELYISIRRFGGETSYAHYDDFLIGSEEEGYELKLLGHY-QGNASDALRTHDKMKFS 345
            :.||||...||.|.:|.|.....||.|..|.|..|:..|.| |||.| :||..|:|..|:.:.||
 Frog   173 YNLTSSGTWELRIDLRDFDNNMYYAKYSFFQILGEDNNYTL-LLGSYNEGNIGDSLTPHNTVPFS 236

  Fly   346 TYDRDNDAFTHMNCAEHHQGAWWYDFCSRSNLNGRYFKGEVDNPQSIYW----EPWYSFRSLKSV 406
            ||||||: |...|||..:||.|||:.|.:|||||.| :...:|...|.|    ...||:   ||.
 Frog   237 TYDRDNN-FLLENCAFDNQGGWWYNNCYQSNLNGLY-RLVQNNETGINWLSDGRNHYSY---KSS 296

  Fly   407 QMLIR 411
            :|.||
 Frog   297 EMKIR 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352
FReD 213..413 CDD:238040 85/199 (43%)
LOC105947509XP_031760299.1 Collagen <65..88 CDD:396114
FReD 93..303 CDD:238040 85/199 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.