DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and Angptl7

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_006239486.1 Gene:Angptl7 / 102552055 RGDID:7553363 Length:408 Species:Rattus norvegicus


Alignment Length:305 Identity:106/305 - (34%)
Similarity:161/305 - (52%) Gaps:38/305 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 EQIKELEQKVKVYET---RLKRKQH-----VLAELRKLNGSSALLIEHLKGKVVYFERKFREKKD 196
            |:::||:.:|....:   .|.|||.     |:.::.:|..||    :.::.::...|.|:.|..:
  Rat   109 EEMRELKAQVANLSSLLGELSRKQESDWVSVVMQVMELESSS----KRMESRLTTAESKYSEMNN 169

  Fly   197 DL-LADWEAATT----------SCVPF----GRSPGIHLIHLPGFL--PFL-VPCEGQTAAGPGW 243
            .: :...:||.|          .|...    .|..|::.:....||  |.| |.|:.:|:.| ||
  Rat   170 QIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDEFLGSPELEVFCDMETSGG-GW 233

  Fly   244 TCIQRRLDGSVNFYRNWDAYSKGFGKLNGEFFIGLEKLHRLTSSQPHELYISIRRFGGETSYAHY 308
            |.||||..|.|:||::|..|.:|||.:.|:|::|.|.:|||| .||..|.:.:..:.|...||.|
  Rat   234 TIIQRRKSGLVSFYQDWKQYKQGFGSIRGDFWLGNEHIHRLT-RQPTRLRVELEDWEGNARYAEY 297

  Fly   309 DDFLIGSEEEGYELKLLGHYQGN-ASDALRTHDKMKFSTYDRDNDAFTHMNCAEHHQGAWWYDFC 372
            ..|.:|:|...|.| .||:|.|| ..|||..|:...|||.|:|||.... .||:..:|.:||:.|
  Rat   298 SYFALGNELNSYRL-FLGNYSGNVGKDALLYHNNTVFSTKDKDNDNCLD-KCAQLRKGGYWYNCC 360

  Fly   373 SRSNLNGRYFK-GE-VDNPQSIYWEPWYSFR-SLKSVQMLIRPKS 414
            :.|||||.|:: || ..:...|.|..|:... |||.|:|.|||::
  Rat   361 TDSNLNGVYYRLGEHRKHMDGISWYGWHGANYSLKRVEMKIRPEA 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352 8/30 (27%)
FReD 213..413 CDD:238040 86/206 (42%)
Angptl7XP_006239486.1 FReD 191..403 CDD:238040 86/215 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.