DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8642 and fcn2l

DIOPT Version :9

Sequence 1:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_004917606.2 Gene:fcn2l / 101735093 XenbaseID:XB-GENE-22167163 Length:301 Species:Xenopus tropicalis


Alignment Length:234 Identity:87/234 - (37%)
Similarity:122/234 - (52%) Gaps:28/234 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 YFERKFREKKD--DLLADWEAATTSCVPFGRSPGIHLIHLPGFLPFLVPCEGQTAAGPGWTCIQR 248
            |..|..:|..|  ::|:||                ::|:..|..|..|.|:..|..| ||...||
 Frog    88 YAARNCKELLDQGEVLSDW----------------YIIYPDGVQPMKVLCDMHTDGG-GWIVFQR 135

  Fly   249 RLDGSVNFYRNWDAYSKGFGKLNGEFFIGLEKLHRLTSSQPHELYISIRRFGGETSYAHYDDFLI 313
            |.||||:|:|:|.:|..|||....||::|.:.||:||||...||.:.::.|.....:|.|:.|.|
 Frog   136 RWDGSVDFFRDWKSYKSGFGSRLNEFWLGNDNLHKLTSSGTWELRVDLQDFENAKHFAKYESFRI 200

  Fly   314 GSEEEGYELKLLGHYQGNASDALRTHDKMKFSTYDRDNDAFTHMNCAEHHQGAWWYDFCSRSNLN 378
            ..|.|.::|.:.....||..||::.|:.|.|||.|:|||.... :||:.::|.|||:.|..||||
 Frog   201 LGESEKFKLLIGAMKGGNIEDAMKVHNTMPFSTKDQDNDILPE-HCADRYKGGWWYNGCHHSNLN 264

  Fly   379 GRYFKGEVDN-PQSIYWEPWYSFR----SLKSVQMLIRP 412
            |.|..|...| .:.|   .||..|    |.|..:|.|||
 Frog   265 GLYLLGSHSNTAEGI---NWYGGRGHNYSYKRSEMKIRP 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352
FReD 213..413 CDD:238040 80/205 (39%)
fcn2lXP_004917606.2 Collagen 38..>79 CDD:396114
FReD 91..300 CDD:238040 84/229 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm14088
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.